DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tin and lms

DIOPT Version :10

Sequence 1:NP_524433.1 Gene:tin / 42536 FlyBaseID:FBgn0004110 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_611491.2 Gene:lms / 37322 FlyBaseID:FBgn0034520 Length:378 Species:Drosophila melanogaster


Alignment Length:137 Identity:50/137 - (36%)
Similarity:72/137 - (52%) Gaps:17/137 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   245 ETASNSSSLRSIYGSDEGAK-------KKDNSQVTSS----RSELRKNSISGNSNPGSNSGSTKP 298
            |..|::|...|:  .||..:       .:.:|..|||    ..:..|:.|...|:.|:..|..: 
  Fly    24 EMRSSTSFEDSV--QDESGRGGNCLGASRASSPATSSCLDDNMDDGKSDIDLASDDGNGLGDDR- 85

  Fly   299 RMKRKPRVLFSQAQVLELECRFRLKKYLTGAEREIIAQKLNLSATQVKIWFQNRRYKSKRG-DID 362
              |::||..||.||:..||..|...|||:.|:|..:|::|.|:.||:||||||||.|.||. ..|
  Fly    86 --KKRPRTAFSAAQIKALETEFERGKYLSVAKRTALAKQLQLTETQIKIWFQNRRTKWKRKYTSD 148

  Fly   363 CEGIAKH 369
            .|.:|.|
  Fly   149 VETLASH 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tinNP_524433.1 Homeodomain 302..358 CDD:459649 28/55 (51%)
lmsNP_611491.2 Cnd2 33..>106 CDD:450400 21/77 (27%)
Homeodomain 87..143 CDD:459649 28/55 (51%)

Return to query results.
Submit another query.