DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tin and nkx3-2

DIOPT Version :9

Sequence 1:NP_524433.1 Gene:tin / 42536 FlyBaseID:FBgn0004110 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_835233.1 Gene:nkx3-2 / 337865 ZFINID:ZDB-GENE-030127-1 Length:245 Species:Danio rerio


Alignment Length:198 Identity:58/198 - (29%)
Similarity:84/198 - (42%) Gaps:47/198 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   225 DSLQAPTQKLCVNPLSQRLMETASNSSSLRSIYGSDEG---------------AKKKDNSQVTSS 274
            |.:.||          :|..||...:      |.||.|               .|..|.:..|..
Zfish    43 DEMDAP----------ERSDETEHKN------YDSDSGLSEDNDAKAQIDAKPEKDADLADETDQ 91

  Fly   275 RSELR--KNSISGNSNPGSNSGSTKPRMKRKPRVLFSQAQVLELECRFRLKKYLTGAEREIIAQK 337
            .|..:  .:.:|..:.....||....:.|::.|..||.|||.|||.||..::||:|.||..:|..
Zfish    92 ESAAKGLSDCVSDCNTAEEKSGDAPKQRKKRSRAAFSHAQVFELERRFNHQRYLSGPERADLAAS 156

  Fly   338 LNLSATQVKIWFQNRRYKSKRGDIDCEGIAKHLKLKSEPLDSPTSLPPPI--------PNHVMWP 394
            |.|:.|||||||||||||:||..:..:.:|      |.|.....::...:        |..::.|
Zfish   157 LKLTETQVKIWFQNRRYKTKRRQMAADLLA------SAPAAKKVAVKVLVRDDRRQYSPGELLRP 215

  Fly   395 PTM 397
            |.:
Zfish   216 PLL 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tinNP_524433.1 HOX 301..357 CDD:197696 33/55 (60%)
nkx3-2NP_835233.1 COG5576 65..>177 CDD:227863 40/111 (36%)
Homeobox 123..176 CDD:278475 32/52 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0842
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.