DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tin and HOXD13

DIOPT Version :9

Sequence 1:NP_524433.1 Gene:tin / 42536 FlyBaseID:FBgn0004110 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_000514.2 Gene:HOXD13 / 3239 HGNCID:5136 Length:343 Species:Homo sapiens


Alignment Length:287 Identity:71/287 - (24%)
Similarity:109/287 - (37%) Gaps:72/287 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 GATTSSSLS------PLLPP---------------PPHQLYGGYQDYGMPAHMFQHHHGHPHQSF 150
            |:::|||.|      |..||               ||          ..||..:.:|.|:.:.|.
Human    84 GSSSSSSSSAVVAARPEAPPAKECPAPTPAAAAAAPP----------SAPALGYGYHFGNGYYSC 138

  Fly   151 QHSASAYNMSASQFYAGASATAYQTPATYNYNYAGSG----EVYGGATPSAVGIKSEYIPTPYVT 211
            :.|               .....|..|..:..:|..|    |.|...:    |:.|..:|...| 
Human   139 RMS---------------HGVGLQQNALKSSPHASLGGFPVEKYMDVS----GLASSSVPANEV- 183

  Fly   212 PSPTLDLNSSAEVDSLQAPTQKLCVNPLSQRLMETASNSSSLRSIYGSDEGAKKKD-----NSQV 271
            |:      .:.||...|..|......|....::.|..:.......|.|.||.:...     ||||
Human   184 PA------RAKEVSFYQGYTSPYQHVPGYIDMVSTFGSGEPRHEAYISMEGYQSWTLANGWNSQV 242

  Fly   272 TSSRSELRKNSISGNSNPGSNSGSTKP-----RMKRKPRVLFSQAQVLELECRFRLKKYLTGAER 331
            ..::.:.:.:....:|.|| :....:|     |..||.||.:::.|:.|||..:.:.|::...:|
Human   243 YCTKDQPQGSHFWKSSFPG-DVALNQPDMCVYRRGRKKRVPYTKLQLKELENEYAINKFINKDKR 306

  Fly   332 EIIAQKLNLSATQVKIWFQNRRYKSKR 358
            ..|:...|||..||.|||||||.|.|:
Human   307 RRISAATNLSERQVTIWFQNRRVKDKK 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tinNP_524433.1 HOX 301..357 CDD:197696 24/55 (44%)
HOXD13NP_000514.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..28
HoxA13_N 39..174 CDD:289085 23/118 (19%)
polyalanine repeat 57..71
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 78..115 8/30 (27%)
homeodomain 277..333 CDD:238039 24/55 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.