DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tin and vnd

DIOPT Version :9

Sequence 1:NP_524433.1 Gene:tin / 42536 FlyBaseID:FBgn0004110 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_476786.2 Gene:vnd / 31003 FlyBaseID:FBgn0261930 Length:723 Species:Drosophila melanogaster


Alignment Length:460 Identity:132/460 - (28%)
Similarity:186/460 - (40%) Gaps:132/460 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LQHHQQQAQSGGYYDHYTQSPSPGSLTNADALNTTPFSVKDILNMVNQTEAYEGSYGHIDGAATA 66
            |.||.....:.|   |..|    ||.|:..||:.||..       |:..|.:.|| |...||..|
  Fly   230 LSHHSASESTSG---HRGQ----GSHTSPSALSPTPAG-------VSADEHHNGS-GTGGGAGEA 279

  Fly    67 SALFAAGEYQNP-----HQYLNHQQHQQSELPIPQQQLHHQHLDDGATTSSSLSPLLPPPPHQLY 126
            .. .:..|:..|     .|:.:||||....|.:|||  |||         .:::||  |..|...
  Fly   280 DH-HSTTEHHAPPSHPQQQHPHHQQHHHPHLLLPQQ--HHQ---------QAVAPL--PLAHHQS 330

  Fly   127 GGYQDYGMPAHMFQHHHGHPHQSFQHSASAYNMSASQFYA----------------GASATAYQT 175
            |..|.           |.|.:.:..|..:::|.:|:...|                |...::|..
  Fly   331 GEAQS-----------HAHANAAAAHLLASHNAAAAAAVAAGQYLPNLPKNFPGSFGDEMSSYHH 384

  Fly   176 PATYNYNYAG------SGEVYGGATP----SAVGIKSE----YIPTPYVTPSPTL--DLNS---S 221
            .|.....::|      ..|:||...|    |...:.||    ||.:...| ||.|  |..|   |
  Fly   385 MAQTMLQHSGRSAWIKENELYGTQQPASPDSTSPVTSEVSYTYIGSNCQT-SPALSGDYKSYSRS 448

  Fly   222 AEVDSLQ-------------------APTQKLCVNPLSQRLMETASNSSSLRS--IYGSDEGAKK 265
            |:.|:|.                   |||.....|..:.   .|.:|:.||::  |.|:..|   
  Fly   449 ADSDALSVGDALHTLHGSSGNGSAGGAPTAHALHNNNNN---TTNNNNHSLKAEGINGAGSG--- 507

  Fly   266 KDNSQVTSSRSELRKNSI----------SGNSNPGSNSGSTKPRMKRKPRVLFSQAQVLELECRF 320
            .|:|        |.::.|          .|:....:|.....|..|||.||||::||..|||.||
  Fly   508 HDDS--------LNEDGIEEDIDDVDDADGSGGGDANGSDGLPNKKRKRRVLFTKAQTYELERRF 564

  Fly   321 RLKKYLTGAEREIIAQKLNLSATQVKIWFQNRRYKSKRGDIDCEGIAKHLKL----KSEPLDSPT 381
            |.::||:..|||.:|..:.|:.|||||||||.|||:||...: :|...|..|    .:.| ..|:
  Fly   565 RQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKTKRAQNE-KGYEGHPGLLHGHATHP-HHPS 627

  Fly   382 SLPPP 386
            :||.|
  Fly   628 ALPSP 632

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tinNP_524433.1 HOX 301..357 CDD:197696 34/55 (62%)
vndNP_476786.2 Homeobox 548..601 CDD:278475 31/52 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 1 0.900 - - E2759_KOG0842
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24340
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.