DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tin and Nkx2-3

DIOPT Version :9

Sequence 1:NP_524433.1 Gene:tin / 42536 FlyBaseID:FBgn0004110 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_001101064.1 Gene:Nkx2-3 / 309389 RGDID:1308521 Length:362 Species:Rattus norvegicus


Alignment Length:378 Identity:102/378 - (26%)
Similarity:132/378 - (34%) Gaps:160/378 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 PSPGSLTNADALNTTPFSVKDILNMVNQTEAYEGSYGHIDGAATASALFAAGEYQNPHQYLNHQQ 86
            |||        :.:||||||||||:..|.        |..||                       
  Rat     4 PSP--------VTSTPFSVKDILNLEQQR--------HFHGA----------------------- 29

  Fly    87 HQQSELPIPQQQLHHQHLDDGATTSSSLSPLLPPPPHQLYGGYQDYGMPAHMFQHHHGHPHQSFQ 151
            |.|:||   :|.||                                                   
  Rat    30 HLQAEL---EQHLH--------------------------------------------------- 40

  Fly   152 HSASAYNMSASQFYAGASATAYQTPATYNYNYAGSGEVYGGATPSAVGIKSEYIPTPYVTPSPTL 216
                    ||....|.|..|          .::.:||    ......|.|..|            
  Rat    41 --------SAPCMLAAAEGT----------QFSDAGE----EDEEEEGEKLSY------------ 71

  Fly   217 DLNSSAEVDSLQAPTQKLCVNPLSQRLMETASNSSSLRSIYGSDEGAKKKDNSQVTSSRS----E 277
             |||.|..:.  .....||    .|..:.|....|.         ...|:...:|.|.||    :
  Rat    72 -LNSLAAAEG--HGVSGLC----PQSYVHTVLRDSC---------SGPKEQEEEVVSERSQKSCQ 120

  Fly   278 LRKN-SISGNSNPGSNSGSTKPRMKRKPRVLFSQAQVLELECRFRLKKYLTGAEREIIAQKLNLS 341
            |:|: ..:|:.....:....|||.:||||||||||||.|||.||:.::||:..|||.:|..|.|:
  Rat   121 LKKSLEAAGDCKASEDGERPKPRSRRKPRVLFSQAQVFELERRFKQQRYLSAPEREHLASSLKLT 185

  Fly   342 ATQVKIWFQNRRYKSKRGDIDCEGIAKHLKLKSEPLDSPTSLPPPIPNHVMWP 394
            :|||||||||||||.||            :.:.:.|:..|..|||.|..|..|
  Rat   186 STQVKIWFQNRRYKCKR------------QRQDKSLELGTHAPPPPPRRVAVP 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tinNP_524433.1 HOX 301..357 CDD:197696 38/55 (69%)
Nkx2-3NP_001101064.1 Homeobox 148..202 CDD:395001 36/53 (68%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0842
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24340
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.