DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tin and nkx2.2a

DIOPT Version :9

Sequence 1:NP_524433.1 Gene:tin / 42536 FlyBaseID:FBgn0004110 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_001295569.1 Gene:nkx2.2a / 30697 ZFINID:ZDB-GENE-980526-403 Length:273 Species:Danio rerio


Alignment Length:231 Identity:80/231 - (34%)
Similarity:107/231 - (46%) Gaps:43/231 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   202 SEYIPTPYVTPSPTLDLNSSAEVDSLQAPTQKLCVNPLSQRLMETASNSSSLRSIYGSDEGAKKK 266
            ||...||.|.....|:   :.:...|:.|......||.::.|..|.|...||..:         .
Zfish    42 SEATKTPGVLVQSPLE---NVQNLPLKNPFYDNSDNPYTRWLATTDSIQYSLHGL---------S 94

  Fly   267 DNSQVTSSRS------ELRKNSISGNSNPGSNSGSTKPRMKRKPRVLFSQAQVLELECRFRLKKY 325
            .|||.||::|      |...|....:|| ||:||.     |||.|||||:||..|||.|||.::|
Zfish    95 ANSQDTSAKSPEPSADESPDNDKETSSN-GSDSGK-----KRKRRVLFSKAQTYELERRFRQQRY 153

  Fly   326 LTGAEREIIAQKLNLSATQVKIWFQNRRYKSKRGDIDCEGIAKHLKLKSEPLDSPTSLPPPI--- 387
            |:..|||.:|..:.|:.|||||||||.|||.||...:     |.:::...|  ||..:..|:   
Zfish   154 LSAPEREHLASLIRLTPTQVKIWFQNHRYKMKRARAE-----KGMEVTHLP--SPRRVAVPVLVR 211

  Fly   388 ---PNHVM----WPPTMQQSQQQQQHHAQQQQMQHM 416
               |.|.:    ...|.|.......:.|  |.:|||
Zfish   212 DGKPCHTLKAQDLAATFQAGIPFSAYSA--QSLQHM 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tinNP_524433.1 HOX 301..357 CDD:197696 35/55 (64%)
nkx2.2aNP_001295569.1 COG5576 93..218 CDD:227863 57/146 (39%)
Homeobox 132..185 CDD:278475 32/52 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0842
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.