DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tin and nkx2.7

DIOPT Version :9

Sequence 1:NP_524433.1 Gene:tin / 42536 FlyBaseID:FBgn0004110 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_571494.1 Gene:nkx2.7 / 30694 ZFINID:ZDB-GENE-990415-179 Length:269 Species:Danio rerio


Alignment Length:217 Identity:75/217 - (34%)
Similarity:99/217 - (45%) Gaps:52/217 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   205 IPTPYV-TPSPTLD---------LN----SSAEVDSLQAPTQKLCVNPLSQRLMETASNSSSLRS 255
            :|:|.. ||....|         ||    ...|.||:  |.|.|.:..:...|      |.||..
Zfish     2 LPSPVTSTPFSVKDILKLEQQQALNPGVFMGVEQDSV--PLQSLQLQCMQNTL------SRSLDL 58

  Fly   256 IYGSDEG-----AKKKDNSQVTSSRSELRKNSISGN----------SNPGSNSGST-----KPRM 300
            :|..::|     .|..|...|.||.....:..:..|          |:..|.:|.|     |.|:
Zfish    59 LYSPEKGIPGEQVKCDDFDIVRSSCGSPTEEEMDANEETSMCPFTDSSYSSKNGETLREKPKQRL 123

  Fly   301 KRKPRVLFSQAQVLELECRFRLKKYLTGAEREIIAQKLNLSATQVKIWFQNRRYKSKRGDIDCEG 365
            :|||||||||.||.|||.||:.::||:..||:.:|..|.|::|||||||||||||.||...|   
Zfish   124 RRKPRVLFSQTQVFELERRFKQQRYLSAPERDHLALALKLTSTQVKIWFQNRRYKCKRQRQD--- 185

  Fly   366 IAKHLKLKSEPLDSPTSLPPPI 387
                   ||..|..|..:..|:
Zfish   186 -------KSLELAGPRRVAVPV 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tinNP_524433.1 HOX 301..357 CDD:197696 36/55 (65%)
nkx2.7NP_571494.1 COG5576 87..210 CDD:227863 51/124 (41%)
Homeobox 127..180 CDD:278475 34/52 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0842
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR24340
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
54.870

Return to query results.
Submit another query.