DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tin and dbx1a

DIOPT Version :10

Sequence 1:NP_524433.1 Gene:tin / 42536 FlyBaseID:FBgn0004110 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_571233.1 Gene:dbx1a / 30394 ZFINID:ZDB-GENE-000128-8 Length:314 Species:Danio rerio


Alignment Length:202 Identity:60/202 - (29%)
Similarity:82/202 - (40%) Gaps:36/202 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   185 GSGEVYGGATPSAVGIKSEYIPTPYVTPSPT-LDLNSSAEVDSLQAPTQKLCVNPLSQRLMETAS 248
            |..|.:|..:|.          ||..:..|| |....||    :.||:.|...:|          
Zfish    80 GITEKHGPCSPK----------TPVSSKDPTYLKFGVSA----ILAPSPKKATSP---------- 120

  Fly   249 NSSSLRSIYGSDEGAKKKDNSQVTSSRSELRKNSISGNSNPGSNS----GSTKPRMKRKPRVLFS 309
              .|:.||:.........|.|.....||.......|....||:.|    ...|||.....|.:||
Zfish   121 --PSVHSIHPKGFSVPYFDGSFCPFVRSSYFPAPSSVVPIPGTFSWPLAARGKPRRGMLRRAVFS 183

  Fly   310 QAQVLELECRFRLKKYLTGAEREIIAQKLNLSATQVKIWFQNRRYK---SKRGDIDCEGIAKH-- 369
            ..|...||..|:.:||::..:|:.:|.||.|..:||||||||||.|   ||..::...|..:.  
Zfish   184 DVQRKALEKMFQKQKYISKPDRKKLAAKLGLKDSQVKIWFQNRRMKWRNSKERELLSSGGCREQT 248

  Fly   370 LKLKSEP 376
            |..|:.|
Zfish   249 LPTKTNP 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tinNP_524433.1 Homeodomain 302..358 CDD:459649 26/58 (45%)
dbx1aNP_571233.1 Homeodomain 178..232 CDD:459649 25/53 (47%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 234..279 5/22 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 292..314
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.