DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tin and hoxd4a

DIOPT Version :9

Sequence 1:NP_524433.1 Gene:tin / 42536 FlyBaseID:FBgn0004110 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_001119917.1 Gene:hoxd4a / 30329 ZFINID:ZDB-GENE-980526-214 Length:256 Species:Danio rerio


Alignment Length:320 Identity:73/320 - (22%)
Similarity:108/320 - (33%) Gaps:121/320 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 SSSLSPLLPPPPHQLYGGYQDYGMPAHMFQHHHGHPHQSFQHSASAYNMSASQFYAGASATAYQT 175
            |..:.|..||        .::|...:::       |.||            ..:|:.:..|.:|.
Zfish    30 SKYVDPKFPP--------CEEYSQNSYI-------PEQS------------PGYYSPSQDTDFQH 67

  Fly   176 PATYN-YNYAGSGEVYGGATPSAVGIKSE-YIPTPYVTPSPTLDLNSSAEVDSLQAPTQKLCVNP 238
            |..|: .||  |.:.|..:|.....::.. ::.....||||            ..|.|:: |  |
Zfish    68 PGIYSRSNY--SEQPYSCSTVQGSSVQPRGHVQDQASTPSP------------FPAQTEQ-C--P 115

  Fly   239 LSQRLMETASNSSSLRSIYGSDEGAKKKDNSQVTSSRSELRKNSISGNSNPGSNSGSTKPRMK-- 301
            ..|              |.||..|.:              ::|:.:.|..|........|.||  
Zfish   116 AVQ--------------ISGSRTGGQ--------------QQNTKTQNGIPTKQPAVVYPWMKKV 152

  Fly   302 --------------RKPRVLFSQAQVLELECRFRLKKYLTGAEREIIAQKLNLSATQVKIWFQNR 352
                          ::.|..:::.||||||..|...:|||...|..||..|.||..|:|||||||
Zfish   153 HVTTVNPDYTGPEPKRSRTAYTRQQVLELEKEFHFNRYLTRRRRIEIAHTLCLSERQIKIWFQNR 217

  Fly   353 RYKSKRGDIDCEGIAKHLKLKSEPLDSPTSLPPPIPNHVMWPPTMQQSQQQQQHHAQQQQ 412
            |.|.|:                              :|.: |.|..:|......|||..|
Zfish   218 RMKWKK------------------------------DHKL-PNTKGRSASVGNQHAQHAQ 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tinNP_524433.1 HOX 301..357 CDD:197696 28/71 (39%)
hoxd4aNP_001119917.1 Homeobox 169..222 CDD:278475 27/52 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.