DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tin and Hoxd13

DIOPT Version :9

Sequence 1:NP_524433.1 Gene:tin / 42536 FlyBaseID:FBgn0004110 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_001099356.1 Gene:Hoxd13 / 288154 RGDID:1308417 Length:331 Species:Rattus norvegicus


Alignment Length:321 Identity:79/321 - (24%)
Similarity:121/321 - (37%) Gaps:74/321 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 AATASALFAAGEYQNPHQYLNHQQHQQSELPIPQQQLHHQHLDDGATTSSSLSPLLP-------- 119
            ||.|:|..||..:..|         ..||             ..|:::|||.|.::.        
  Rat    50 AAAAAAAAAASSFAYP---------GTSE-------------RTGSSSSSSSSAVIATRPEAPVA 92

  Fly   120 ---PPPHQLYGGYQDYGMPAHMFQHHHGHPHQSFQHSASAYNMSASQFYAGASATAYQTPATYNY 181
               |.|..........|.||..:.:|.|:.:.|.:.|               .....|..|..:.
  Rat    93 KECPAPAAAATAAAPPGAPALGYGYHFGNGYYSCRMS---------------HGVGLQQNALKSS 142

  Fly   182 NYAGSG----EVYGGATPSAVGIKSEYIPTPYVTPSPTLDLNSSAEVDSLQAPTQKLCVNPLSQR 242
            .:|..|    |.|...:    |:.|..:||..| |:      .:.||...|..|......|....
  Rat   143 PHASLGGFPVEKYMDVS----GLASSSVPTNEV-PA------RAKEVSFYQGYTSPYQHVPGYID 196

  Fly   243 LMETASNSSSLRSIYGSDEGAKKKD-----NSQVTSSRSELRKNSISGNSNPGSNSGSTKP---- 298
            ::.|..:.......|.|.||.:...     ||||..::.:.:.:....:|.|| :....:|    
  Rat   197 MVSTFGSGEPRHEAYISMEGYQSWTLANGWNSQVYCAKDQPQGSHFWKSSFPG-DVALNQPDMCV 260

  Fly   299 -RMKRKPRVLFSQAQVLELECRFRLKKYLTGAEREIIAQKLNLSATQVKIWFQNRRYKSKR 358
             |..||.||.:::.|:.|||..:.:.|::...:|..|:...|||..||.|||||||.|.|:
  Rat   261 YRRGRKKRVPYTKLQLKELENEYAINKFINKDKRRRISAATNLSERQVTIWFQNRRVKDKK 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tinNP_524433.1 HOX 301..357 CDD:197696 24/55 (44%)
Hoxd13NP_001099356.1 HoxA13_N <113..162 CDD:289085 11/67 (16%)
homeodomain 265..321 CDD:238039 24/55 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.