DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tin and VAX2

DIOPT Version :10

Sequence 1:NP_524433.1 Gene:tin / 42536 FlyBaseID:FBgn0004110 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_036608.1 Gene:VAX2 / 25806 HGNCID:12661 Length:290 Species:Homo sapiens


Alignment Length:121 Identity:44/121 - (36%)
Similarity:56/121 - (46%) Gaps:13/121 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   245 ETASNSSSLRSIYGSDEGAKKKDNSQVTSSRSELR-------KNSISGNSNPGSNSGSTKPRMKR 302
            |.|..|:|  |..||.|.....|...........|       |.:|.....|   .|....|.||
Human    45 EVAGTSAS--SPAGSRESGADSDGQPGPGEADHCRRILVRDAKGTIREIVLP---KGLDLDRPKR 104

  Fly   303 KPRVLFSQAQVLELECRFRLKKYLTGAEREIIAQKLNLSATQVKIWFQNRRYKSKR 358
             .|..|:..|:..||..|:..:|:.|.||..:|::||||.||||:||||||.|.|:
Human   105 -TRTSFTAEQLYRLEMEFQRCQYVVGRERTELARQLNLSETQVKVWFQNRRTKQKK 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tinNP_524433.1 Homeodomain 302..358 CDD:459649 27/55 (49%)
VAX2NP_036608.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..75 9/31 (29%)
Homeodomain 103..159 CDD:459649 28/56 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 205..240
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.