DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tin and Nkx2-1

DIOPT Version :9

Sequence 1:NP_524433.1 Gene:tin / 42536 FlyBaseID:FBgn0004110 Length:416 Species:Drosophila melanogaster
Sequence 2:XP_006240178.1 Gene:Nkx2-1 / 25628 RGDID:3866 Length:423 Species:Rattus norvegicus


Alignment Length:454 Identity:109/454 - (24%)
Similarity:148/454 - (32%) Gaps:205/454 - (45%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 HYTQSP-SPGSLTNADALNTTPFSVKDILNMVNQTEAYEGSYGHIDGAATASALFAAGEYQNPHQ 80
            |.|:|. |...:.:....:||||||.|||:.:.::....|..|...||..|:             
  Rat    40 HPTRSALSRRRIMSMSPKHTTPFSVSDILSPLEESYKKVGMEGGGLGAPLAA------------- 91

  Fly    81 YLNHQQHQQSELPIPQQQLHHQHLDDGATTSSSLSPLLPPPPHQLYGGYQDYGMPAHMFQHHHGH 145
               ::|.|.:                              ||            .|.|.||..||
  Rat    92 ---YRQGQAA------------------------------PP------------AAAMQQHAVGH 111

  Fly   146 PHQSFQHSA--SAYNMSASQFYAGASATAYQTPATYNYNYAGSGEVYGGATPSAVGIKSEYIPTP 208
                  |.|  :||:|:|    ||....::              ...||.....:|..|| :| |
  Rat   112 ------HGAVTAAYHMTA----AGVPQLSH--------------SAVGGYCNGNLGNVSE-LP-P 150

  Fly   209 YVTPSPTLDLNSSAEVDSLQAPTQKLCVNPLSQRLMETASNSSSLRSIYGSDEGAKKKDNSQVTS 273
            |                                  .:|..||:|....||::...:....|:...
  Rat   151 Y----------------------------------QDTMRNSASGPGWYGANPDPRFPAISRFMG 181

  Fly   274 SRSELRKNSISGNSNPGSNSGSTKP---RMKRKPRVLFSQAQVLELECRFRLKKYLTGAEREIIA 335
            ..|.:..:.:.|..:.|..|.:..|   ..:||.|||||||||.|||.||:.:|||:..|||.:|
  Rat   182 PASGMNMSGMGGLGSLGDVSKNMAPLPSAPRRKRRVLFSQAQVYELERRFKQQKYLSAPEREHLA 246

  Fly   336 QKLNLSATQVKIWFQNRRYKSKR----------------------GDIDCEGIAKHLKLKSEPLD 378
            ..::|:.|||||||||.|||.||                      |...|               
  Rat   247 SMIHLTPTQVKIWFQNHRYKMKRQAKDKAAQQQLQQDSGGGGGGGGGAGC--------------- 296

  Fly   379 SPTSLPPPIPNHVMWPPTMQQSQQQQ----------------------------QHHAQQQQMQ 414
                            |..||:|||.                            |.|||||..|
  Rat   297 ----------------PQQQQAQQQSPRRVAVPVLVKDGKPCQAGAPAPGAASLQGHAQQQAQQ 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tinNP_524433.1 HOX 301..357 CDD:197696 36/55 (65%)
Nkx2-1XP_006240178.1 Homeobox 215..268 CDD:278475 34/52 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0842
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.