DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tin and ceh-28

DIOPT Version :9

Sequence 1:NP_524433.1 Gene:tin / 42536 FlyBaseID:FBgn0004110 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_510169.4 Gene:ceh-28 / 191619 WormBaseID:WBGene00000450 Length:201 Species:Caenorhabditis elegans


Alignment Length:179 Identity:65/179 - (36%)
Similarity:88/179 - (49%) Gaps:42/179 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   196 SAVGIKSEYIPTPYVTPSPT---------LDL-----NSSAEVDSLQAPTQKLCVNPLSQR--LM 244
            :.|.:.||.|..|..:..|:         |:|     .|.:|:.:...|     |.||.||  |:
 Worm     9 TTVILPSEVIQPPQQSAVPSEFKNTLPSRLNLFEGFDQSFSELTNPYQP-----VIPLMQRESLL 68

  Fly   245 ETASNSSSLRSIYGSDEGAKKKDNSQVTSSRSELRKNSISGNSNPGSNSGSTKPRMKRKPRVLFS 309
            ..:|..||......|.:..::..|....:.||:                     :.||||||||:
 Worm    69 GASSYYSSPSQNQRSYQNHRQHSNPDTINLRSQ---------------------QQKRKPRVLFT 112

  Fly   310 QAQVLELECRFRLKKYLTGAEREIIAQKLNLSATQVKIWFQNRRYKSKR 358
            |.||.|||.||:.::|:|..|||.:||.|.|:||||||||||||||.||
 Worm   113 QHQVNELEERFKKQRYVTATEREELAQCLGLTATQVKIWFQNRRYKCKR 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tinNP_524433.1 HOX 301..357 CDD:197696 39/55 (71%)
ceh-28NP_510169.4 HOX 104..160 CDD:197696 39/55 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0842
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR24340
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.