DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tin and ceh-16

DIOPT Version :9

Sequence 1:NP_524433.1 Gene:tin / 42536 FlyBaseID:FBgn0004110 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_001379631.1 Gene:ceh-16 / 191618 WormBaseID:WBGene00000439 Length:187 Species:Caenorhabditis elegans


Alignment Length:227 Identity:57/227 - (25%)
Similarity:92/227 - (40%) Gaps:66/227 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   205 IPTPYVTPSPTLDLNSSAEVDSLQAPTQKLCVNPLSQRLMETASNSSSLRSIYGSDEGAKKKDNS 269
            :.:||..||||:.                           ..|::.||:...:.|..|.....:|
 Worm    11 LSSPYPCPSPTIS---------------------------TPATSPSSISPTFASPNGTPNIASS 48

  Fly   270 Q----VTSSR-----------SELRKNSISGNSNPGSNSGSTKPRMKRKPRVLFSQAQVLELECR 319
            .    |.|:|           .:.||...:|      :|||::.  :::||..|:..|:..|:..
 Worm    49 MYPAWVFSTRYSDRPSAGPRHRKSRKRESTG------SSGSSEE--EKRPRTAFTGDQLDRLKTE 105

  Fly   320 FRLKKYLTGAEREIIAQKLNLSATQVKIWFQNRRYKSKRGDIDCEGIAKHLKLKSEPLDSPTSLP 384
            ||..:|||...|:.:|.:|.|:.:|:||||||:|.|.|:            ...|.|.|..:|:.
 Worm   106 FRESRYLTEKRRQELAHELGLNESQIKIWFQNKRAKLKK------------STSSVPRDRCSSVT 158

  Fly   385 PPIPNHVMWPPTMQQSQQQQQHHAQQQQMQHM 416
            |...||    |::....|.....|:.|...:|
 Worm   159 PNPHNH----PSIHGGYQLMAQLAKVQARAYM 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tinNP_524433.1 HOX 301..357 CDD:197696 23/55 (42%)
ceh-16NP_001379631.1 Homeobox 90..144 CDD:395001 23/53 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 59 1.000 Inparanoid score I4021
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.