DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tin and R03G8.1

DIOPT Version :9

Sequence 1:NP_524433.1 Gene:tin / 42536 FlyBaseID:FBgn0004110 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_510172.2 Gene:R03G8.1 / 187544 WormBaseID:WBGene00010996 Length:663 Species:Caenorhabditis elegans


Alignment Length:296 Identity:58/296 - (19%)
Similarity:86/296 - (29%) Gaps:102/296 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   205 IPTPYVTPSPTLDLNSSAEVDSLQAPTQKL-------CVNPLSQRLMETASNSSSLRSIYGSDEG 262
            |.|.|..| .|.|:......|:.:.|...:       .:||....|.:..::...|..:..|..|
 Worm    34 IHTDYAAP-VTEDILVGNSWDTCELPRYDVWDEELFGYLNPNENPLKKCDTSFKPLTKLENSKWG 97

  Fly   263 AKKKDNSQVTSSRSELR---KNSISGN--SNPG-----------SNSGS---------------T 296
            .....| ....:|...|   |.::.||  ..||           :..|.               |
 Worm    98 VTFAHN-LTCRARCHTRKRDKENLVGNWTYTPGKINCEILETVCAEKGGEQRDVYGYLHSQIIPT 161

  Fly   297 KPRMKRKPRVL--------------FSQ-AQVLELECRFRLKKYLTGAEREIIAQKLNLSATQ-- 344
            ||::.|....|              :|| |:.|.....| .|.|:.|    ||...:|.....  
 Worm   162 KPKLSRTNADLKEYDVFVILLDSLSYSQAARSLPRTVSF-FKSYMKG----IIFPYMNKVGDNSR 221

  Fly   345 ---VKIWFQNRRYKSKR-------------GDIDCEGIAKHLKLKSEPLDSPTSLPPPIPNH--- 390
               |.:||.....|..|             .|..| .:.|         |:.|||......|   
 Worm   222 PNGVALWFGKLLEKVDRFIFDKPSLEADWTDDYFC-NVFK---------DNETSLFDEFKTHGYK 276

  Fly   391 -----------VMWPPTMQQSQQQQQHHAQQQQMQH 415
                       ::||..:....|...|:.:..|:.|
 Worm   277 TLMAEDWALGTLIWPNCLGYRNQSIDHYMRPFQLAH 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tinNP_524433.1 HOX 301..357 CDD:197696 17/75 (23%)
R03G8.1NP_510172.2 DUF229 74..651 CDD:281053 48/255 (19%)
ALP_like 175..483 CDD:293745 30/153 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0842
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.