DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tin and R03G8.3

DIOPT Version :9

Sequence 1:NP_524433.1 Gene:tin / 42536 FlyBaseID:FBgn0004110 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_510174.3 Gene:R03G8.3 / 181437 WormBaseID:WBGene00010998 Length:654 Species:Caenorhabditis elegans


Alignment Length:279 Identity:52/279 - (18%)
Similarity:93/279 - (33%) Gaps:91/279 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   157 YNMSASQFYAGASATAYQTPATYNYNYA------GSGEVYGGATPSAVGIKSEYIPTPYVTPSPT 215
            ||:..:..|         ||...|....      |..:|||       .:.::.|.||  ...||
 Worm   135 YNVIGNWTY---------TPGPINCEVVEAVCADGKKDVYG-------FLHTQVIATP--PKQPT 181

  Fly   216 LDLNSSAEVDSLQAPTQKLCVNPLSQRLMETASNSSSLRSIYGSDEGAKKKDNSQVTSSRSEL-- 278
            :.::.....|     ...:.::.||    .|.:..|.||:|            |.:|:....:  
 Worm   182 VKVSELKNYD-----VTVIMLDSLS----FTQAKRSLLRTI------------SYMTNHMDAVLF 225

  Fly   279 -RKNSISGNSNPGSNSGSTKPRMKRKPRVLFSQAQV-LELECRFRLKKYLTGAEREIIAQKLNLS 341
             ..|.:..||.|...:......:::..|.||.:..| ::....:....|... |..:..:     
 Worm   226 PYINKVGDNSRPNGAALWFGKSLEKLDRSLFEEENVPVDWSHAYMCHVYKDN-ETSLFKE----- 284

  Fly   342 ATQVKIWFQNRRYKS------KRGDI---DCEGIAKHLKLKSEPLDSPTSLPPPIPNHVMWPPTM 397
                   :||..||:      ..|.:   :|:|..|                ||| :|:|.|   
 Worm   285 -------YQNYGYKTLMAEDWAEGTLNWPNCKGFDK----------------PPI-DHLMRP--- 322

  Fly   398 QQSQQQQQHHAQQQQMQHM 416
            .|:..::.:|.:.....|:
 Worm   323 FQNALERANHGEPLTKSHL 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tinNP_524433.1 HOX 301..357 CDD:197696 10/62 (16%)
R03G8.3NP_510174.3 DUF229 92..570 CDD:281053 52/279 (19%)
ALP_like 190..480 CDD:293745 37/206 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0842
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.