DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tin and vab-15

DIOPT Version :9

Sequence 1:NP_524433.1 Gene:tin / 42536 FlyBaseID:FBgn0004110 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_509648.1 Gene:vab-15 / 181197 WormBaseID:WBGene00006881 Length:225 Species:Caenorhabditis elegans


Alignment Length:170 Identity:54/170 - (31%)
Similarity:76/170 - (44%) Gaps:34/170 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   206 PTPYVTPSPTL--DLNSSAEVDSLQAPTQKLCVNPLSQRLMETASNSS-------------SLRS 255
            |||....:|.|  .|:........|.....:.......||...:|:||             ||:.
 Worm    34 PTPITPKTPMLIPGLHPMTPYFGAQLDPVMIYFAQTGNRLPIVSSDSSPESCASSPLSMQHSLQW 98

  Fly   256 IYGSDEGAKKKDNS--QVTSSRSELRKNSISGNSNPGSNSGSTKPRMKRKPRVLFSQAQVLELEC 318
            :....|.:...|::  |:..|:..|||:                 :..||||..||..|::.||.
 Worm    99 LSSQREDSPTSDDAKIQIGLSKCMLRKH-----------------KNNRKPRTPFSTQQLISLER 146

  Fly   319 RFRLKKYLTGAEREIIAQKLNLSATQVKIWFQNRRYKSKR 358
            :|:.|:||:.|||...:..|.|:.|||||||||||.||||
 Worm   147 KFQSKQYLSIAERAEFSASLQLTETQVKIWFQNRRAKSKR 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tinNP_524433.1 HOX 301..357 CDD:197696 30/55 (55%)
vab-15NP_509648.1 Homeobox 132..185 CDD:278475 28/52 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X657
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.