DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tin and Nkx3-1

DIOPT Version :9

Sequence 1:NP_524433.1 Gene:tin / 42536 FlyBaseID:FBgn0004110 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_035051.1 Gene:Nkx3-1 / 18095 MGIID:97352 Length:237 Species:Mus musculus


Alignment Length:105 Identity:48/105 - (45%)
Similarity:59/105 - (56%) Gaps:21/105 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   288 NPGSNSGS---TKPRMKRKPRVLFSQAQVLELECRFRLKKYLTGAEREIIAQKLNLSATQVKIWF 349
            |||..:.:   ||...||. |..||..||:|||.:|..:|||:..||..:|:.|.|:.|||||||
Mouse   110 NPGDLASAPQVTKQPQKRS-RAAFSHTQVIELERKFSHQKYLSAPERAHLAKNLKLTETQVKIWF 173

  Fly   350 QNRRYKSKRGDIDCEGIAKHLKLKSEPL-----DSPTSLP 384
            ||||||:||            |..||.|     :||.|||
Mouse   174 QNRRYKTKR------------KQLSEDLGVLEKNSPLSLP 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tinNP_524433.1 HOX 301..357 CDD:197696 32/55 (58%)
Nkx3-1NP_035051.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..96
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 108..130 7/20 (35%)
Homeobox 128..181 CDD:278475 30/53 (57%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0842
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.