DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tin and Nkx2-9

DIOPT Version :9

Sequence 1:NP_524433.1 Gene:tin / 42536 FlyBaseID:FBgn0004110 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_032727.2 Gene:Nkx2-9 / 18094 MGIID:1270158 Length:235 Species:Mus musculus


Alignment Length:155 Identity:66/155 - (42%)
Similarity:82/155 - (52%) Gaps:35/155 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   232 QKLCVNPLSQRLMETASNSSSLRSIY-GSDEG---AKKKDNSQVTSSRSELRKNSISGNSNPGSN 292
            |:.||       .:||:...|..|.| .|||.   ....|:||:.|.|.|          :|||:
Mouse    30 QQTCV-------PQTAAWLESECSHYLSSDESGLETSPADSSQLASLRRE----------SPGSD 77

  Fly   293 SGSTKPRMKRKPRVLFSQAQVLELECRFRLKKYLTGAEREIIAQKLNLSATQVKIWFQNRRYKSK 357
                 |..:||.|||||:||.||||.|||.::||:..|||.:|:.|.|:.|||||||||.|||.|
Mouse    78 -----PEKRRKRRVLFSKAQTLELERRFRQQRYLSAPEREQLARLLRLTPTQVKIWFQNHRYKLK 137

  Fly   358 RGDIDCEGIAKHLKLKSEPLDSPTS 382
            ||  ...||       :||.|...|
Mouse   138 RG--RAPGI-------TEPSDMAAS 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tinNP_524433.1 HOX 301..357 CDD:197696 36/55 (65%)
Nkx2-9NP_032727.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 51..86 15/49 (31%)
Homeobox 84..138 CDD:365835 34/53 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0842
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.