Sequence 1: | NP_524433.1 | Gene: | tin / 42536 | FlyBaseID: | FBgn0004110 | Length: | 416 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_035050.2 | Gene: | Nkx2-6 / 18092 | MGIID: | 97351 | Length: | 289 | Species: | Mus musculus |
Alignment Length: | 211 | Identity: | 72/211 - (34%) |
---|---|---|---|
Similarity: | 94/211 - (44%) | Gaps: | 50/211 - (23%) |
- Green bases have known domain annotations that are detailed below.
Fly 211 TPSPTLDL--NSSAEVDSLQAPTQKLCVNPLSQRLMETASNSSSLRSIYGSDEGAKKKDNSQVTS 273
Fly 274 SRS------ELRKNSIS------------GNSNP------GSNSG--------STKPRMKRKPRV 306
Fly 307 LFSQAQVLELECRFRLKKYLTGAEREIIAQKLNLSATQVKIWFQNRRYKSKRGDIDCEGIAKHLK 371
Fly 372 LKSEPLDSPTSLPPPI 387 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
tin | NP_524433.1 | HOX | 301..357 | CDD:197696 | 38/55 (69%) |
Nkx2-6 | NP_035050.2 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 75..125 | 10/49 (20%) | |
Homeobox | 126..179 | CDD:278475 | 36/52 (69%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 259..289 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG0842 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 1 | 1.050 | 115 | 1.000 | Inparanoid score | I4814 |
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | LDO | PTHR24340 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
5 | 4.960 |