DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tin and ceh-22

DIOPT Version :9

Sequence 1:NP_524433.1 Gene:tin / 42536 FlyBaseID:FBgn0004110 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_001343841.1 Gene:ceh-22 / 179485 WormBaseID:WBGene00000445 Length:379 Species:Caenorhabditis elegans


Alignment Length:288 Identity:72/288 - (25%)
Similarity:109/288 - (37%) Gaps:80/288 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 DDGATTSSSLSPLLPPPPHQLYGGYQDYGMPAHMFQHHHGHPHQSFQHSASAYNMSASQFYAGAS 169
            |.||.:|:|.:...|          |.....|...:..|.:.|.........|::.:.:|:...|
 Worm    46 DGGAASSASSASAAP----------QQQSQSALHNKTFHFYIHNFSIRVIHFYSIISKKFFGENS 100

  Fly   170 ------------------------------ATAYQTPATYNYNYAGSGEVYGGATPSAVGIKSEY 204
                                          .:.|....|::::..    .||...|||....:..
 Worm   101 KSLEAKWDTLLPTDTNLQCSTWPDSIPLLAVSGYSATPTFSFDPC----TYGSYDPSAYFASNGI 161

  Fly   205 IPTPYVTPSPTLDLNSSAEVDSLQAPTQKLCVNPLSQRLMETASNSSSLRSIYGSDEGAKKKDNS 269
            ..:.|..|    |....:|.|.|                    .||::........:|.|.:|..
 Worm   162 AGSMYTLP----DQFPRSENDML--------------------DNSNTSNGNKSDKDGIKLEDED 202

  Fly   270 QVTSSRSELRKNSISGNSNPGSNSGSTKPRMKRKPRVLFSQAQVLELECRFRLKKYLTGAEREII 334
            ::           :....|...:.|:.| |.|||.||||::||..|||.|||.:|||:..|||.:
 Worm   203 EI-----------LEDEENDEEDDGTGK-RKKRKRRVLFTKAQTYELERRFRSQKYLSAPEREAL 255

  Fly   335 AQKLNLSATQVKIWFQNRRYKSKRGDID 362
            |.::.|:.|||||||||.|||:|:...|
 Worm   256 AMQIRLTPTQVKIWFQNHRYKTKKSHTD 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tinNP_524433.1 HOX 301..357 CDD:197696 35/55 (64%)
ceh-22NP_001343841.1 Homeobox 229..279 CDD:365835 29/49 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.