DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tin and Hoxd13

DIOPT Version :9

Sequence 1:NP_524433.1 Gene:tin / 42536 FlyBaseID:FBgn0004110 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_032301.2 Gene:Hoxd13 / 15433 MGIID:96205 Length:339 Species:Mus musculus


Alignment Length:321 Identity:79/321 - (24%)
Similarity:121/321 - (37%) Gaps:74/321 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 AATASALFAAGEYQNPHQYLNHQQHQQSELPIPQQQLHHQHLDDGATTSSSLSPLLP-------- 119
            ||.|:|..||..:..|         ..||             ..|:::|||.|.::.        
Mouse    58 AAAAAAAAAASSFAYP---------GTSE-------------RTGSSSSSSSSAVIATRPEAPVA 100

  Fly   120 ---PPPHQLYGGYQDYGMPAHMFQHHHGHPHQSFQHSASAYNMSASQFYAGASATAYQTPATYNY 181
               |.|..........|.||..:.:|.|:.:.|.:.|               .....|..|..:.
Mouse   101 KECPAPAAAATAAAPPGAPALGYGYHFGNGYYSCRMS---------------HGVGLQQNALKSS 150

  Fly   182 NYAGSG----EVYGGATPSAVGIKSEYIPTPYVTPSPTLDLNSSAEVDSLQAPTQKLCVNPLSQR 242
            .:|..|    |.|...:    |:.|..:||..| |:      .:.||...|..|......|....
Mouse   151 PHASLGGFPVEKYMDVS----GLASSSVPTNEV-PA------RAKEVSFYQGYTSPYQHVPGYID 204

  Fly   243 LMETASNSSSLRSIYGSDEGAKKKD-----NSQVTSSRSELRKNSISGNSNPGSNSGSTKP---- 298
            ::.|..:.......|.|.||.:...     ||||..::.:.:.:....:|.|| :....:|    
Mouse   205 MVSTFGSGEPRHEAYISMEGYQSWTLANGWNSQVYCAKDQPQGSHFWKSSFPG-DVALNQPDMCV 268

  Fly   299 -RMKRKPRVLFSQAQVLELECRFRLKKYLTGAEREIIAQKLNLSATQVKIWFQNRRYKSKR 358
             |..||.||.:::.|:.|||..:.:.|::...:|..|:...|||..||.|||||||.|.|:
Mouse   269 YRRGRKKRVPYTKLQLKELENEYAINKFINKDKRRRISAATNLSERQVTIWFQNRRVKDKK 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tinNP_524433.1 HOX 301..357 CDD:197696 24/55 (44%)
Hoxd13NP_032301.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..33
HoxA13_N <121..168 CDD:403486 10/65 (15%)
Homeobox 275..329 CDD:395001 22/53 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.