DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tin and NKX2-5

DIOPT Version :9

Sequence 1:NP_524433.1 Gene:tin / 42536 FlyBaseID:FBgn0004110 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_004378.1 Gene:NKX2-5 / 1482 HGNCID:2488 Length:324 Species:Homo sapiens


Alignment Length:375 Identity:100/375 - (26%)
Similarity:127/375 - (33%) Gaps:164/375 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 PSPGSLTNADALNTTPFSVKDILNMVNQTEAYEGSYGHIDGAATASALFAAGEYQNPHQYLNHQQ 86
            |||       ||..||||||||||:..|..                :|.||||            
Human     3 PSP-------ALTPTPFSVKDILNLEQQQR----------------SLAAAGE------------ 32

  Fly    87 HQQSELPIPQQQLHHQHLDDGATTSSSLSPLLPPPPHQLYGGYQDYGMPAHMFQHHHGHPHQSFQ 151
                                   .|:.|...|.|....|                          
Human    33 -----------------------LSARLEATLAPSSCML-------------------------- 48

  Fly   152 HSASAYNMSASQFYAGASATAYQTP-ATYNYNYAGSGEVYGGATPSAVGIKSEYIPTPYVTPSPT 215
               :|:...|   |||..|.|...| .......|.|......|.|:|    ..:.|..|..|.|.
Human    49 ---AAFKPEA---YAGPEAAAPGLPELRAELGRAPSPAKCASAFPAA----PAFYPRAYSDPDPA 103

  Fly   216 LDLNSSAEVDSLQAPTQKLCVNPLSQRLMETASNSSSLRSIYGSDEGAKKKDNSQVTSSRSELRK 280
            .|         .:|..::||....:..|.:|.::                               
Human   104 KD---------PRAEKKELCALQKAVELEKTEAD------------------------------- 128

  Fly   281 NSISGNSNPGSNSGSTKPRMKRKPRVLFSQAQVLELECRFRLKKYLTGAEREIIAQKLNLSATQV 345
                       |:...:.|.:||||||||||||.|||.||:.::||:..||:.:|..|.|::|||
Human   129 -----------NAERPRARRRRKPRVLFSQAQVYELERRFKQQRYLSAPERDQLASVLKLTSTQV 182

  Fly   346 KIWFQNRRYKSKRGDIDCEGIAKHLKLKSEPLDSPTSLPPPIPNHVMWPP 395
            ||||||||||.||...|     :.|:|        ..||||.|     ||
Human   183 KIWFQNRRYKCKRQRQD-----QTLEL--------VGLPPPPP-----PP 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tinNP_524433.1 HOX 301..357 CDD:197696 37/55 (67%)
NKX2-5NP_004378.1 Homeobox 145..194 CDD:278475 31/48 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0842
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24340
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
54.870

Return to query results.
Submit another query.