DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tin and NKX2-6

DIOPT Version :9

Sequence 1:NP_524433.1 Gene:tin / 42536 FlyBaseID:FBgn0004110 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_001129743.2 Gene:NKX2-6 / 137814 HGNCID:32940 Length:301 Species:Homo sapiens


Alignment Length:104 Identity:55/104 - (52%)
Similarity:68/104 - (65%) Gaps:6/104 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   284 SGNSNPGSNSGSTKPRMKRKPRVLFSQAQVLELECRFRLKKYLTGAEREIIAQKLNLSATQVKIW 348
            ||:|..|..|...|.|.:|||||||||||||.||.||:.::||:..|||.:|..|.|::||||||
Human   115 SGDSVRGGRSEQPKARQRRKPRVLFSQAQVLALERRFKQQRYLSAPEREHLASALQLTSTQVKIW 179

  Fly   349 FQNRRYKSKRGDIDCEGIAKHLKLKSEPLDSPTSLPPPI 387
            |||||||.||...|     |.|:|...|| :|..:..|:
Human   180 FQNRRYKCKRQRQD-----KSLELAGHPL-TPRRVAVPV 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tinNP_524433.1 HOX 301..357 CDD:197696 38/55 (69%)
NKX2-6NP_001129743.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 22..135 8/19 (42%)
HOX 132..188 CDD:197696 38/55 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0842
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR24340
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.