DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tin and Nkx2-5

DIOPT Version :9

Sequence 1:NP_524433.1 Gene:tin / 42536 FlyBaseID:FBgn0004110 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_446103.2 Gene:Nkx2-5 / 114109 RGDID:620520 Length:319 Species:Rattus norvegicus


Alignment Length:372 Identity:98/372 - (26%)
Similarity:126/372 - (33%) Gaps:171/372 - (45%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 PSPGSLTNADALNTTPFSVKDILNMVNQTEAYEGSYGHIDGAATASALFAAGEYQNPHQYLNHQQ 86
            |||       ||..||||||||||:..|..:                 .|||             
  Rat     3 PSP-------ALTHTPFSVKDILNLEQQQRS-----------------LAAG------------- 30

  Fly    87 HQQSELPIPQQQLHHQHLDDGATTSSSLSPLLPPPPHQLYGGYQDYGMPAHMFQHHHGHPHQSFQ 151
                              |..|...::|:|                                   
  Rat    31 ------------------DLSARLEATLAP----------------------------------- 42

  Fly   152 HSASAYNMSASQFYAGASATAYQTPATYNYNYAGSGEVYGGATPSAVGIKSEYIPTPYVTP---S 213
                     ||...|.....||..|.              .|.|....:::|..|.|  :|   |
  Rat    43 ---------ASCMLAAFKPEAYSGPE--------------AAAPGLAELRAELGPAP--SPPKCS 82

  Fly   214 PTLDLNSSAEVDSLQAPTQKLCVNPLSQRLMETASNSSSLRSIYGSDEGAK--KKDNSQVTSSRS 276
            |...          .|||    ..|.:                ||..:.||  :.|..::.:.:.
  Rat    83 PAFP----------TAPT----FYPRA----------------YGDPDPAKDPRADKKELCALQK 117

  Fly   277 --ELRKNSISGNSNPGSNSGSTKPRMKRKPRVLFSQAQVLELECRFRLKKYLTGAEREIIAQKLN 339
              ||.|....|...|       :.|.:||||||||||||.|||.||:.::||:..||:.:|..|.
  Rat   118 AVELDKAETDGAERP-------RARRRRKPRVLFSQAQVYELERRFKQQRYLSAPERDQLASVLK 175

  Fly   340 LSATQVKIWFQNRRYKSKRGDIDCEGIAKHLKLKSEPLDSPTSLPPP 386
            |::|||||||||||||.||...|     :.|:|...|       |||
  Rat   176 LTSTQVKIWFQNRRYKCKRQRQD-----QTLELLGPP-------PPP 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tinNP_524433.1 HOX 301..357 CDD:197696 37/55 (67%)
Nkx2-5NP_446103.2 Homeobox 144..194 CDD:395001 31/49 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0842
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24340
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
65.870

Return to query results.
Submit another query.