DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tin and nkx2-5

DIOPT Version :9

Sequence 1:NP_524433.1 Gene:tin / 42536 FlyBaseID:FBgn0004110 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_001116891.1 Gene:nkx2-5 / 100144646 XenbaseID:XB-GENE-487966 Length:300 Species:Xenopus tropicalis


Alignment Length:189 Identity:64/189 - (33%)
Similarity:95/189 - (50%) Gaps:33/189 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   213 SPTLDLNSSAEVDSLQAPTQKL-------CVNPLSQRLMETASN--------SSSLRSIYGSDEG 262
            || :|:.|..|..|....|.|.       |::.|::.|.:..|:        |..:::....|..
 Frog    27 SP-MDITSRLENSSCMLSTFKQEPYPGTPCLSELTEELAQRDSSKGPSPFPGSFFVKNYLEMDSS 90

  Fly   263 AKKKDNSQVTSSRSELRKNSISGNSNPGSNSGSTKPRMKRKPRVLFSQAQVLELECRFRLKKYLT 327
            ...||:.:   ....|:| ::..:.....:....:.|.:||||||||||||.|||.||:.:|||:
 Frog    91 KDPKDDKK---DICPLQK-TLEHDKREAEDPERPRQRKRRKPRVLFSQAQVYELERRFKQQKYLS 151

  Fly   328 GAEREIIAQKLNLSATQVKIWFQNRRYKSKRGDIDCEGIAKHLKLKSEPLDSPTSLPPP 386
            ..||:.:|..|.|::|||||||||||||.||            :.:.:.|:. ..||||
 Frog   152 APERDHLANVLKLTSTQVKIWFQNRRYKCKR------------QRQDQTLEM-VGLPPP 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tinNP_524433.1 HOX 301..357 CDD:197696 38/55 (69%)
nkx2-5NP_001116891.1 Homeobox 132..182 CDD:365835 32/49 (65%)
COG5576 <133..235 CDD:227863 38/78 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24340
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.