DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tin and nkx2-6

DIOPT Version :9

Sequence 1:NP_524433.1 Gene:tin / 42536 FlyBaseID:FBgn0004110 Length:416 Species:Drosophila melanogaster
Sequence 2:XP_002932599.1 Gene:nkx2-6 / 100038094 XenbaseID:XB-GENE-486951 Length:254 Species:Xenopus tropicalis


Alignment Length:164 Identity:58/164 - (35%)
Similarity:76/164 - (46%) Gaps:33/164 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   242 RLMETASNSSSLRSIYGSDE---GAKKKD--------------NSQVTSSRSELRKNSISGNSNP 289
            ||......|:.:||..|:|.   ||.::|              :.|:........::...|....
 Frog    18 RLENGQVGSAPVRSHPGTDPLLIGAARRDPIERDRESPGAFCQSPQIEDPDFAQEQSGYFGGLGR 82

  Fly   290 GSNSGSTKPRMKRKPRVLFSQAQVLELECRFRLKKYLTGAEREIIAQKLNLSATQVKIWFQNRRY 354
            |........|.:|||||||||.||.|||.||:.::||:..|||.:|..|.|::||||||||||||
 Frog    83 GGPQEQLHHRQRRKPRVLFSQMQVFELERRFKQQRYLSAPEREQLALALKLTSTQVKIWFQNRRY 147

  Fly   355 KSKRGDIDCEGIAKHLKLKSEPLDSPTSLPPPIP 388
            |.||                :..|....|..|||
 Frog   148 KCKR----------------QKQDRSLELGHPIP 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tinNP_524433.1 HOX 301..357 CDD:197696 37/55 (67%)
nkx2-6XP_002932599.1 Homeobox 97..151 CDD:365835 35/53 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR24340
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.