DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tin and nkx2-2

DIOPT Version :9

Sequence 1:NP_524433.1 Gene:tin / 42536 FlyBaseID:FBgn0004110 Length:416 Species:Drosophila melanogaster
Sequence 2:XP_002939477.1 Gene:nkx2-2 / 100038077 XenbaseID:XB-GENE-482219 Length:271 Species:Xenopus tropicalis


Alignment Length:206 Identity:72/206 - (34%)
Similarity:98/206 - (47%) Gaps:41/206 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   227 LQAPTQKLCVNPLSQRLMETASNSSSLRSIYGSDEGAKKKDNSQVTSSRSELRKN---SISGNSN 288
            |::|......||.::.|..|.|...||.....|        |||..||......:   |...:.:
 Frog    61 LKSPFYDSSDNPYTRWLATTESIQYSLHGFASS--------NSQQDSSPKSPEPSADESPDNDKD 117

  Fly   289 PGSNSGSTKPRMKRKPRVLFSQAQVLELECRFRLKKYLTGAEREIIAQKLNLSATQVKIWFQNRR 353
            |.:|..|.|   |||.|||||:||..|||.|||.::||:..|||.:|..:.|:.|||||||||.|
 Frog   118 PSTNPDSGK---KRKRRVLFSKAQTYELERRFRQQRYLSAPEREHLASLIRLTPTQVKIWFQNHR 179

  Fly   354 YKSKRGDIDCEGIAKHLKLKSEPLDSPTSLPPPI------PNHVM--------WPPTM------Q 398
            ||.||...: :|      ::..||.||..:..|:      |.|.:        :|..:      .
 Frog   180 YKMKRARAE-KG------MEVTPLPSPRRVAVPVLVRDGKPCHTLKAQDLAATFPAGIPFSAYSA 237

  Fly   399 QSQQQQQHHAQ 409
            ||.|..|::||
 Frog   238 QSLQHMQYNAQ 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tinNP_524433.1 HOX 301..357 CDD:197696 35/55 (64%)
nkx2-2XP_002939477.1 LAP1C 21..>149 CDD:368520 36/98 (37%)
COG5576 93..216 CDD:227863 55/140 (39%)
Homeobox 130..184 CDD:365835 32/53 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002404
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.