DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SIFaR and Hcrtr2

DIOPT Version :9

Sequence 1:NP_001163674.1 Gene:SIFaR / 42530 FlyBaseID:FBgn0038880 Length:758 Species:Drosophila melanogaster
Sequence 2:NP_037206.1 Gene:Hcrtr2 / 25605 RGDID:2788 Length:460 Species:Rattus norvegicus


Alignment Length:404 Identity:131/404 - (32%)
Similarity:197/404 - (48%) Gaps:65/404 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   201 YRHSLAMSMVYCVAYIVVFLVGLIGNSFVIAVVLRAPRMRTVTNYFIVNLAIADILVIVFCLPAT 265
            |.|......|....||:||:|.||||..|...|.:...||||||||||||::||:||.:.|||||
  Rat    47 YLHPKEYEWVLIAGYIIVFVVALIGNVLVCVAVWKNHHMRTVTNYFIVNLSLADVLVTITCLPAT 111

  Fly   266 LIGNIFVPWMLGWLMCKFVPYIQGVSVAASVYSLIAVSLDRFIAIWWPLK-QMTKRRARIMIIGI 329
            |:.:|...|..|..:||.:||:|.|||:.||.:|..::|||:.||..||. :.|.:|||..|:.|
  Rat   112 LVVDITETWFFGQSLCKVIPYLQTVSVSVSVLTLSCIALDRWYAICHPLMFKSTAKRARNSIVVI 176

  Fly   330 WVIALVTTIPWLLFFD-------LVPAEEVFSDALVSAYSQPQFLCQEVWPPGTDGNLYFLLANL 387
            |:::.:..||..:..:       |.....:|:            :|.|.|.......:|.:...|
  Rat   177 WIVSCIIMIPQAIVMERSSMLPGLANKTTLFT------------VCDERWGGEVYPKMYHICFFL 229

  Fly   388 VACYLLPMSLITLCYVLIWIKVSTRSIPGESKDAQMDRMQ-----------QKSKV--------- 432
            |. |:.|:.|:.|.|:.|:.|:..|.|||.|...|....|           |:||.         
  Rat   230 VT-YMAPLCLMVLAYLQIFRKLWCRQIPGTSSVVQRKWKQPQPVSQPRGSGQQSKARISAVAAEI 293

  Fly   433 -------KVIKMLVAVVILFVLSWLPLYV--IFARIKFGSDISQEEFEILKKVMPVAQWLGSSNS 488
                   |..:||:.|:::|.:.:||:.:  :..|: ||.....|:.|.:......:.||..:||
  Rat   294 KQIRARRKTARMLMVVLLVFAICYLPISILNVLKRV-FGMFTHTEDRETVYAWFTFSHWLVYANS 357

  Fly   489 CINPILYS-VNKKYRRGFAAIIKSRSCC--GRLRYYDNVAIASSTTSTRKSSHYHQNSSRKSPSS 550
            ..|||:|: ::.|:|..|.|..   |||  ...|..|.:|...::|.:||        |..:..|
  Rat   358 AANPIIYNFLSGKFREEFKAAF---SCCLGVHRRQGDRLARGRTSTESRK--------SLTTQIS 411

  Fly   551 KGNAVSYIYEHNSL 564
            ..:.||.:.||.:|
  Rat   412 NFDNVSKLSEHVAL 425

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SIFaRNP_001163674.1 7tm_4 216..>443 CDD:304433 91/261 (35%)
7tm_1 225..495 CDD:278431 100/306 (33%)
Hcrtr2NP_037206.1 Required for response to orexin-A. /evidence=ECO:0000250|UniProtKB:O43614 33..49 1/1 (100%)
7tm_4 65..>185 CDD:304433 58/119 (49%)
7tm_1 71..364 CDD:278431 100/306 (33%)
Orexin_rec2 386..443 CDD:281778 13/48 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166354579
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm9048
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X258
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.