DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3301 and YMR226C

DIOPT Version :9

Sequence 1:NP_001287440.1 Gene:CG3301 / 42528 FlyBaseID:FBgn0038878 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_013953.1 Gene:YMR226C / 855266 SGDID:S000004839 Length:267 Species:Saccharomyces cerevisiae


Alignment Length:260 Identity:69/260 - (26%)
Similarity:124/260 - (47%) Gaps:25/260 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 RWLNRVAVVTGASAGIGAACCRDLVAKG---MVVVGLARREKVLQDIKSSLPADQA---ARFHTR 61
            |...:..::||||||||.|...:.:...   |.::..|||.:.|:::|.::  ||.   |:.|..
Yeast    10 RLAKKTVLITGASAGIGKATALEYLEASNGDMKLILAARRLEKLEELKKTI--DQEFPNAKVHVA 72

  Fly    62 PCDVSNEQQVIDTFAWIDRTLGGADVLVNNAGIIRQMNITDPENSADVRAILDVNVLGVTWCTRQ 126
            ..|::..:::......:.:.....|:||||||.....:......:.|::.:.|.||..:...| |
Yeast    73 QLDITQAEKIKPFIENLPQEFKDIDILVNNAGKALGSDRVGQIATEDIQDVFDTNVTALINIT-Q 136

  Fly   127 WFLSLQRRKVNDGHVVVINSVVGHSVPAVEGFSLNMYAPSKHAITALTEILRQEFIKKGTQTKIT 191
            ..|.:.:.| |.|.:|.:.|:.|.......    ::|..||.|:.|.|:.||:|.|  .|:.::.
Yeast   137 AVLPIFQAK-NSGDIVNLGSIAGRDAYPTG----SIYCASKFAVGAFTDSLRKELI--NTKIRVI 194

  Fly   192 SISPGVVATE---IFEAGSWEQPTGM-----PMLRSEDIADAVTYCIQTPPTVQIKELIIKPVGE 248
            .|:||:|.||   :...|:.||...:     |:: ::|:||.:.|.........|.:.:|.|..:
Yeast   195 LIAPGLVETEFSLVRYRGNEEQAKNVYKDTTPLM-ADDVADLIVYATSRKQNTVIADTLIFPTNQ 258

  Fly   249  248
            Yeast   259  258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3301NP_001287440.1 YdfG 1..250 CDD:226674 69/260 (27%)
NADB_Rossmann 1..245 CDD:304358 68/255 (27%)
YMR226CNP_013953.1 SDR_c5 14..266 CDD:187604 68/256 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1205
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000588
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100320
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.760

Return to query results.
Submit another query.