DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3301 and NRE1

DIOPT Version :9

Sequence 1:NP_001287440.1 Gene:CG3301 / 42528 FlyBaseID:FBgn0038878 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_012301.3 Gene:NRE1 / 854853 SGDID:S000001474 Length:254 Species:Saccharomyces cerevisiae


Alignment Length:209 Identity:56/209 - (26%)
Similarity:93/209 - (44%) Gaps:35/209 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LNRVAVVTGASAGIGAACCRDLVA--KGMVVVGLARREKVLQDIKSSLPADQAARFHTRPCDVSN 67
            :.:|.:|||.|.|||.:....|.:  |..||.|:||.|..|:.:|..    ...||.....|::.
Yeast     1 MGKVILVTGVSRGIGKSIVDVLFSLDKDTVVYGVARSEAPLKKLKEK----YGDRFFYVVGDITE 61

  Fly    68 E---QQVIDTFAWIDRTLGGADVLVNNAGIIRQM-NITDPENSADVRA---ILDVNVLGVTWCTR 125
            :   :|:::...   :..|..|.||.|||::..: |:    |..||.|   :.|:|...:.....
Yeast    62 DSVLKQLVNAAV---KGHGKIDSLVANAGVLEPVQNV----NEIDVNAWKKLYDINFFSIVSLVG 119

  Fly   126 QWFLSLQRRKVNDGHVVVINSVVGHSVPAVEGF--SLNMYAPSKHAITALTEILRQEFIKKGTQT 188
               ::|...|..:|:||.::|      .|...:  |...|..||.|:......|..|    ..|.
Yeast   120 ---IALPELKKTNGNVVFVSS------DACNMYFSSWGAYGSSKAALNHFAMTLANE----ERQV 171

  Fly   189 KITSISPGVVATEI 202
            |..:::||:|.|::
Yeast   172 KAIAVAPGIVDTDM 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3301NP_001287440.1 YdfG 1..250 CDD:226674 56/209 (27%)
NADB_Rossmann 1..245 CDD:304358 56/209 (27%)
NRE1NP_012301.3 SPR-like_SDR_c 4..246 CDD:187625 56/206 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157341289
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.