DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3301 and NYC1

DIOPT Version :9

Sequence 1:NP_001287440.1 Gene:CG3301 / 42528 FlyBaseID:FBgn0038878 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_567400.1 Gene:NYC1 / 826942 AraportID:AT4G13250 Length:496 Species:Arabidopsis thaliana


Alignment Length:272 Identity:67/272 - (24%)
Similarity:113/272 - (41%) Gaps:59/272 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 RVAVVTGASAGIGAACCRDLVAKGMVVVGLARR-----------EKVLQDIKSSLPADQAARFHT 60
            |..|:||::.|:|.|..|:.:..|..|:..:|.           |:.|::|.|:  |.::||...
plant   162 RNVVITGSTRGLGKALAREFLLSGDRVIVTSRSSESVDMTVKELEQNLKEIMSN--ASESARKKL 224

  Fly    61 R-------PCDVSNEQQVIDTFAWIDRTLGGADVLVNNAGIIRQMNITDPENSADVRAILDVNVL 118
            .       .|||...:.|.....:..:.||..::.:||||..:...........|:..|:..|::
plant   225 SDAKVVGIACDVCKPEDVEKLSNFAVKELGSINIWINNAGTNKGFRPLLEFTEEDITQIVSTNLI 289

  Fly   119 GVTWCTRQWFLSLQRRKVNDGHVVVINSV--VGHSVPAVEGFSLNMYAPSKHAITALTEILRQ-- 179
            |...||| ..:.:..|:.:.||:..::..  .|.|.|...     :|..:|..       |||  
plant   290 GSILCTR-GAMDVMSRQHSGGHIFNMDGAGSGGSSTPLTA-----VYGSTKCG-------LRQFH 341

  Fly   180 -EFIKKGTQTKI--TSISPGVVATEIFEAGS-----------WEQP-----TGMPMLR-SEDIAD 224
             ..:|:..:|.:  .:.|||:|.||:..:||           .|.|     |.:|.:| .:....
plant   342 GSIVKESQKTNVGLHTASPGMVLTELLLSGSSIKNKQMFNIICELPETVARTLVPRMRVVKGSGK 406

  Fly   225 AVTYCIQTPPTV 236
            ||.|.  |||.:
plant   407 AVNYL--TPPRI 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3301NP_001287440.1 YdfG 1..250 CDD:226674 67/272 (25%)
NADB_Rossmann 1..245 CDD:304358 67/272 (25%)
NYC1NP_567400.1 SDR_c 164..395 CDD:212491 58/245 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 86 1.000 Domainoid score I2775
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1190834at2759
OrthoFinder 1 1.000 - - FOG0000588
OrthoInspector 1 1.000 - - mtm1174
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.