DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3301 and dhrs11a

DIOPT Version :9

Sequence 1:NP_001287440.1 Gene:CG3301 / 42528 FlyBaseID:FBgn0038878 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_001093518.1 Gene:dhrs11a / 791578 ZFINID:ZDB-GENE-060929-324 Length:258 Species:Danio rerio


Alignment Length:270 Identity:101/270 - (37%)
Similarity:148/270 - (54%) Gaps:39/270 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNRWLNRVAVVTGASAGIGAACCRDLVAKGMVVVGLARR----EKVLQDIKSSLPADQAARFHTR 61
            |.||..|||:|||||.|||||..|.||..||.|||.||.    ||:..:.:|   |..:......
Zfish     4 MERWKGRVALVTGASVGIGAAVARALVQHGMKVVGCARNVDKIEKLAAECQS---AGYSGILIPY 65

  Fly    62 PCDVSNEQQVIDTFAWIDRTLGGADVLVNNAGIIRQMNITDPENSADV---RAILDVNVLGVTWC 123
            .||:.||::::..|:.|.....|.||.:||||:..    .:|..|...   |.::|||:|.:..|
Zfish    66 KCDLCNEEEILSMFSAIKTLHQGVDVCINNAGLAH----NEPLLSGRTDGWRNMIDVNILALAIC 126

  Fly   124 TRQWFLSLQRRKVNDGHVVVINSVVGHSVPAVEGFSLNMYAPSKHAITALTEILRQEFIKKGTQT 188
            ||:.:.|::.|.|:|||::.|||:.||.:  |.....:.|..:|:|:||:||.||||..:..|..
Zfish   127 TREAYQSMRERHVDDGHIININSMGGHRM--VSSADEHFYCATKYAVTAMTEGLRQELREAKTHI 189

  Fly   189 KITSISPGVVATE---------------IFEAGSWEQPTGMPMLRSEDIADAVTYCIQTPPTVQI 238
            :.|.||||:|.||               ::|:        :..|::||||.||||.:..|..|||
Zfish   190 RATCISPGIVETEFAFRHHNSDPERAAAVYES--------IKCLKAEDIASAVTYVLSAPAHVQI 246

  Fly   239 KELIIKPVGE 248
            .::.::||.:
Zfish   247 GDVQMRPVDQ 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3301NP_001287440.1 YdfG 1..250 CDD:226674 101/270 (37%)
NADB_Rossmann 1..245 CDD:304358 99/265 (37%)
dhrs11aNP_001093518.1 YdfG 4..258 CDD:226674 101/270 (37%)
Mgc4172-like_SDR_c 4..253 CDD:187601 99/265 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170576257
Domainoid 1 1.000 169 1.000 Domainoid score I3763
eggNOG 1 0.900 - - E2759_KOG1205
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 200 1.000 Inparanoid score I3745
OMA 1 1.010 - - QHG45743
OrthoDB 1 1.010 - - D1190834at2759
OrthoFinder 1 1.000 - - FOG0000588
OrthoInspector 1 1.000 - - mtm6354
orthoMCL 1 0.900 - - OOG6_100320
Panther 1 1.100 - - O PTHR43115
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X367
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1413.860

Return to query results.
Submit another query.