DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3301 and dhrs7

DIOPT Version :9

Sequence 1:NP_001287440.1 Gene:CG3301 / 42528 FlyBaseID:FBgn0038878 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_001038811.1 Gene:dhrs7 / 751626 ZFINID:ZDB-GENE-060825-21 Length:338 Species:Danio rerio


Alignment Length:231 Identity:69/231 - (29%)
Similarity:106/231 - (45%) Gaps:38/231 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 RVAVVTGASAGIGAACCRDLVAKGMVVVGLARREKVLQDIK------SSLPADQAARFHTRPCDV 65
            :|..:||||:|||......|.|.|..:|..||||..|:.:|      |||.|:...   ..|.| 
Zfish    50 KVVWITGASSGIGEELSLQLAAIGARLVLSARRENELERVKRLCLERSSLKAEDIL---VLPLD- 110

  Fly    66 SNEQQVIDTFAWIDRT------LGGADVLVNNAGIIRQMNITDPENSADV---RAILDVNVLGVT 121
                 ::|..:..::|      .|..|||:||.|..::....|    |||   :|::::|.||..
Zfish   111 -----LMDRASHPEKTTAALEHFGEIDVLINNGGRSQRALCVD----ADVDVYQALMELNYLGTV 166

  Fly   122 WCTRQWFLSLQRRKVNDGHVVVINSVVGH-SVPAVEGFSLNMYAPSKHAITALTEILRQEFIKKG 185
            ..|:|....:.:|  ..|.:..::||.|. .||...|     ||.||||:......||.| :...
Zfish   167 SITKQVLPHMIQR--GTGIIATVSSVAGFVGVPLATG-----YAASKHALQGFFNSLRTE-LSDC 223

  Fly   186 TQTKITSISPGVVATEIFEAGSWEQPTGMPMLRSED 221
            ....|::|.||.|.:.|.: .::.:..|.|:..:.|
Zfish   224 PNILISNICPGPVISSIVQ-NAFTEELGKPVATAGD 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3301NP_001287440.1 YdfG 1..250 CDD:226674 69/231 (30%)
NADB_Rossmann 1..245 CDD:304358 69/231 (30%)
dhrs7NP_001038811.1 11beta-HSD1_like_SDR_c 47..307 CDD:187593 69/231 (30%)
adh_short 50..249 CDD:278532 66/220 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1205
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.