DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3301 and Rdh8

DIOPT Version :9

Sequence 1:NP_001287440.1 Gene:CG3301 / 42528 FlyBaseID:FBgn0038878 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_001162065.1 Gene:Rdh8 / 690953 RGDID:1589829 Length:312 Species:Rattus norvegicus


Alignment Length:273 Identity:62/273 - (22%)
Similarity:109/273 - (39%) Gaps:76/273 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 VVTGASAGIGAACCRDLVAKGMVVVGLAR--REK-----VLQDIKSSLPADQAA------RFHTR 61
            :::|.|:|||..          :.|.||.  |::     .::|:....|.:.||      .....
  Rat     9 LISGCSSGIGLE----------LAVQLAHDPRQRYQVVATMRDLGKKEPLEAAAGEALGKTLSVA 63

  Fly    62 PCDVSNEQQVIDTFAWIDRTLGGADVLVNNAGI-----IRQMNITDPENSADVRAILDVNVLGVT 121
            ..||.:::.|.:..:.|:.  |..|:||||||:     :..:::...:|      :.:.|..|..
  Rat    64 QLDVCSDESVTNCLSHIEG--GQVDILVNNAGVGLVGPLEDLSLATMQN------VFNTNFFGAV 120

  Fly   122 WCTRQWFLSLQRRKVNDGHVVVINSVVGHSVPAVEGFSLN-MYAPSKHAITALTEILRQEFIKKG 185
            ...:.....::||:  .||:||::||:|     ::|...| :||.||.|:....|.|..:.  :.
  Rat   121 RLVKAVLPGMKRRR--QGHIVVVSSVMG-----LQGVMFNDVYAASKFALEGFFESLAIQL--RQ 176

  Fly   186 TQTKITSISPGVVATEIFEAGSWEQ----------------------PTGMPMLRS-----EDIA 223
            ....|:.:.||.|.|: ||.....|                      |....:.||     .|:|
  Rat   177 FNIFISMVEPGPVITD-FEGKLLAQVSKTEFPDTDPETLGYFRDLYLPASRELFRSVGQSPRDVA 240

  Fly   224 DAVTYCIQT--PP 234
            ..:...|.:  ||
  Rat   241 QVIAKVIGSTRPP 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3301NP_001287440.1 YdfG 1..250 CDD:226674 62/273 (23%)
NADB_Rossmann 1..245 CDD:304358 62/273 (23%)
Rdh8NP_001162065.1 NADB_Rossmann 8..262 CDD:304358 62/273 (23%)
adh_short 8..201 CDD:278532 53/219 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1205
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.