Sequence 1: | NP_001287440.1 | Gene: | CG3301 / 42528 | FlyBaseID: | FBgn0038878 | Length: | 250 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_021326304.1 | Gene: | dhrs7b / 550454 | ZFINID: | ZDB-GENE-050417-277 | Length: | 316 | Species: | Danio rerio |
Alignment Length: | 203 | Identity: | 69/203 - (33%) |
---|---|---|---|
Similarity: | 100/203 - (49%) | Gaps: | 16/203 - (7%) |
- Green bases have known domain annotations that are detailed below.
Fly 6 NRVAVVTGASAGIGAACCRDLVAKGMVVVGLARREKVLQDIKSSLPADQAARFHT-RPC----DV 65
Fly 66 SNEQQVIDTFAWIDRTLGGADVLVNNAGIIRQMNITDPENSADVRAILDVNVLGVTWCTRQWFLS 130
Fly 131 LQRRKVNDGHVVVINSVVGH-SVPAVEGFSLNMYAPSKHAITALTEILRQEFIKKGTQTKITSIS 194
Fly 195 PGVVATEI 202 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG3301 | NP_001287440.1 | YdfG | 1..250 | CDD:226674 | 69/203 (34%) |
NADB_Rossmann | 1..245 | CDD:304358 | 69/203 (34%) | ||
dhrs7b | XP_021326304.1 | 11beta-HSD1_like_SDR_c | 42..303 | CDD:187593 | 69/203 (34%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG1205 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |