DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3301 and CG31546

DIOPT Version :9

Sequence 1:NP_001287440.1 Gene:CG3301 / 42528 FlyBaseID:FBgn0038878 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_730973.1 Gene:CG31546 / 40691 FlyBaseID:FBgn0051546 Length:264 Species:Drosophila melanogaster


Alignment Length:210 Identity:53/210 - (25%)
Similarity:95/210 - (45%) Gaps:22/210 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 RVAVVTGASAGIGAACCRDLVAKGMVVVGLARREKVLQDIKSSLPADQAARFHTRPCDVSNE--- 68
            :|.::|||::|||||........|..:..:.|.|:.|..:..     :..:....|..::.:   
  Fly    14 KVVLITGAASGIGAAAAEMFSKLGACLALVDREEEGLICVMK-----RCMKMGHEPYGIAGDLLK 73

  Fly    69 QQVIDTFA--WIDRTLGGADVLVNNAGIIRQMNITDPENSADVRAILDVNVLGVTWCTRQWFLSL 131
            ...|:..|  ..:|..|..|||||.|||:....:...| .|....:::.||....:.|:.....|
  Fly    74 PPEIECIARKTTERYEGKLDVLVNGAGIMPTGTLQSTE-LACFTHVMEANVRSGFYLTKLLLPQL 137

  Fly   132 QRRKVNDGHVVVINSVVG-HSVPAVEGFSLNMYAPSKHAITALTEILRQEFIKKGTQTKITSISP 195
            .:.|   |.:|.::||.| .:.|     :|..|..||.|:...|..|..:...:|  .::.:::|
  Fly   138 LQCK---GSIVNVSSVCGLRAFP-----NLVAYNMSKAAVDQFTRSLALDLGPQG--VRVNAVNP 192

  Fly   196 GVVATEIFEAGSWEQ 210
            ||:.|.:.:||..::
  Fly   193 GVIRTNLQKAGGMDE 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3301NP_001287440.1 YdfG 1..250 CDD:226674 53/210 (25%)
NADB_Rossmann 1..245 CDD:304358 53/210 (25%)
CG31546NP_730973.1 fabG 9..257 CDD:235975 53/210 (25%)
NADB_Rossmann 11..261 CDD:304358 53/210 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435143
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.