DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3301 and CG12171

DIOPT Version :9

Sequence 1:NP_001287440.1 Gene:CG3301 / 42528 FlyBaseID:FBgn0038878 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_649563.1 Gene:CG12171 / 40690 FlyBaseID:FBgn0037354 Length:257 Species:Drosophila melanogaster


Alignment Length:253 Identity:73/253 - (28%)
Similarity:120/253 - (47%) Gaps:40/253 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNRWLNRVAVVTGASAGIGAACCRDLVAKG--MVVVG--LARREKVLQDIKSS--LPADQAARFH 59
            |..:.::|.:|||||:||||.....|...|  :.:||  |.:..:..:.|.::  .||.|.|   
  Fly     1 MPSFKDKVIIVTGASSGIGAGTSVLLAKLGGLLTIVGRNLDKLNETAEQIVAAGGAPALQVA--- 62

  Fly    60 TRPCDVSNEQQVIDTFAWIDRTL---GGADVLVNNAGIIRQMNITDPENSA--DVRAILDVNVLG 119
               .|:::|.   |....:..||   |..|||||||||:...:|   ||::  ....:::.||..
  Fly    63 ---ADINSES---DVQGIVSATLAKHGRIDVLVNNAGILELGSI---ENTSLEQFDRVMNTNVRS 118

  Fly   120 VTWCTRQWFLSLQRRKVNDGHVVVINSVVG-HSVPAVEGFSLNMYAPSKHAITALTEILRQEFIK 183
            :...|......|.:.|   |::|.::||.| .|.|.|..:::     ||.|:...|..:..|...
  Fly   119 LYQLTHLVTPELIKTK---GNIVNVSSVNGIRSFPGVLAYNV-----SKAAVDQFTRCVALELAP 175

  Fly   184 KGTQTKITSISPGVVATEIFEAGSWEQPTGMPMLRSEDIADAVTYCIQTPPTVQIKEL 241
            ||  .::.|::|||:.||:...|..:|...:..|...    .||:.:..|.  ::||:
  Fly   176 KG--VRVNSVNPGVIITELQRRGGLDQEAYVKFLEHA----KVTHALGRPG--EVKEV 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3301NP_001287440.1 YdfG 1..250 CDD:226674 73/253 (29%)
NADB_Rossmann 1..245 CDD:304358 73/253 (29%)
CG12171NP_649563.1 fabG 2..251 CDD:235975 72/252 (29%)
NADB_Rossmann 4..254 CDD:304358 72/250 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435091
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.