DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3301 and hsd17b1

DIOPT Version :9

Sequence 1:NP_001287440.1 Gene:CG3301 / 42528 FlyBaseID:FBgn0038878 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_991147.2 Gene:hsd17b1 / 402842 ZFINID:ZDB-GENE-040901-5 Length:293 Species:Danio rerio


Alignment Length:210 Identity:65/210 - (30%)
Similarity:101/210 - (48%) Gaps:38/210 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 RVAVVTGASAGIGAACCRDLV---AKGMVVV----GLARREKVLQDI----KSSLPADQAARFHT 60
            :|.::||.|:|||.:....|.   ||...|.    .|.:::::|:.:    |.:|...|      
Zfish     4 KVVLITGCSSGIGLSLAVHLASNPAKAYKVYATMRNLDKKQRLLESVRGLHKDTLDILQ------ 62

  Fly    61 RPCDVSNEQQVIDTFAWIDRTLGGADVLVNNAGIIRQMNITDPENSADVRAILDVNVLGVTWCTR 125
              .||:::|.::|  |..:.:.|..|:||.||| :..|...:..:...:|||||||:|| |..|.
Zfish    63 --MDVTDQQSILD--AQRNVSEGRIDILVCNAG-VGLMGPLETHSLDTIRAILDVNLLG-TIRTI 121

  Fly   126 QWFLSLQRRKVNDGHVVVINSVVGHSVPAVEGFSLN-MYAPSKHAITALTE---ILRQEFIKKGT 186
            |.||...::| ..|.::|..|:.|     ::|...| :|..||.||....|   ||.|.|     
Zfish   122 QTFLPDMKKK-RHGRILVTGSMGG-----LQGLPFNEVYCASKFAIEGACESLAILLQHF----- 175

  Fly   187 QTKITSISPGVVATE 201
            ...|:.|..|.|.|:
Zfish   176 NIHISLIECGPVNTD 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3301NP_001287440.1 YdfG 1..250 CDD:226674 65/210 (31%)
NADB_Rossmann 1..245 CDD:304358 65/210 (31%)
hsd17b1NP_991147.2 SDR 4..257 CDD:330230 65/210 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1205
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.