DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3301 and hsd11b1la

DIOPT Version :9

Sequence 1:NP_001287440.1 Gene:CG3301 / 42528 FlyBaseID:FBgn0038878 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_956617.2 Gene:hsd11b1la / 393293 ZFINID:ZDB-GENE-040426-1002 Length:287 Species:Danio rerio


Alignment Length:268 Identity:63/268 - (23%)
Similarity:99/268 - (36%) Gaps:68/268 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 VVTGASAGIGAACCRDLVAKGMVVVGLARREKVLQDIKSSLPADQAARFHTRPCDVSNEQQVIDT 74
            :|||||.|||..........|..:|..|||..||:.:.|......|.:....|.|::|.......
Zfish    37 LVTGASTGIGEQLAYHYARLGAQIVITARRGNVLEQVVSKCREMGAQKAFYIPADMANPSDADLV 101

  Fly    75 FAWIDRTLGGADVLV-NNAGIIRQMNITDPENSAD-----VRAILDVNVLGVTWCTRQWFLSLQR 133
            ..:....|||.|.|| |:.|       ..|....|     .|.:|:||.|......::...:|::
Zfish   102 VKYAIEQLGGLDYLVLNHIG-------PSPYQMWDGDVQHTRWLLEVNFLSYLQMAQKALPTLEK 159

  Fly   134 RKVNDGHVVVINSVVG-----HSVPAVEGFSLNMYAPSKHAITALTEILRQEFIKKGTQTKITSI 193
            .|   |.:||::|::|     .::|         ||.:|.|:......|:.|...:.:...||..
Zfish   160 SK---GSIVVVSSLLGKICGPFALP---------YASTKFALNGFFGGLQNELAMQKSNVSITIC 212

  Fly   194 SPGVV-----------------------ATEIFEAGSWEQPTG---------------MPMLRSE 220
            ..|::                       |.:|.:||:..|...               .|.||.:
Zfish   213 ILGLIDTDSAMEKIKGYINMTAYPSHEAALQIIQAGATRQSESFYPWYTFYATLFRDWFPYLRDK 277

  Fly   221 DIADAVTY 228
            .|.::.||
Zfish   278 VIQNSYTY 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3301NP_001287440.1 YdfG 1..250 CDD:226674 63/268 (24%)
NADB_Rossmann 1..245 CDD:304358 63/268 (24%)
hsd11b1laNP_956617.2 11beta-HSD1_like_SDR_c 31..278 CDD:187593 60/259 (23%)
adh_short 36..229 CDD:278532 52/210 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1205
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.