DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3301 and CG10672

DIOPT Version :9

Sequence 1:NP_001287440.1 Gene:CG3301 / 42528 FlyBaseID:FBgn0038878 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_647946.1 Gene:CG10672 / 38598 FlyBaseID:FBgn0035588 Length:317 Species:Drosophila melanogaster


Alignment Length:250 Identity:65/250 - (26%)
Similarity:113/250 - (45%) Gaps:40/250 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNRWLNRVAVVTGASAGIGAACCRDLVAKGMVVVGLARREKVLQDIKSSLPADQAARF--HTRPC 63
            |.|...:|||||.::.|||.|..:.|...|..||..:|::|   ::.|:|...:....  |...|
  Fly    66 MKRLAGKVAVVTASTDGIGFAIAKRLAEDGAAVVISSRKQK---NVDSALAELRKLNLNVHGLKC 127

  Fly    64 DVSNEQQVIDTFAWIDRTLGGADVLVNNAGIIRQMNITDPENSADVRA-------ILDVNVLGVT 121
            .||..:.....|.......|..::||:||.       |:|.....:..       |.||||.. :
  Fly   128 HVSEPEDRKQLFEETISKFGKLNILVSNAA-------TNPAVGGVLECDEKVWDKIFDVNVKS-S 184

  Fly   122 WCTRQWFLSLQRRKVNDGHVVVINSVVGHSVPAVEGFS-LNMYAPSKHAITALTEILRQEFIKKG 185
            :...:..|.|.|::.|.. :|.::|:.|:     :.|. |..|:.||.|:..||:...::...:|
  Fly   185 YLLAKEALPLLRQQKNSS-IVFVSSIAGY-----DAFELLGAYSVSKTALIGLTKAAAKDLAPEG 243

  Fly   186 TQTKITSISPGVVATEIFEAGSWEQPTG-------MPMLR---SEDIADAVTYCI 230
              .::..::|||:.|: |....:|..:.       :||.|   ||::|..|::.:
  Fly   244 --IRVNCLAPGVIRTK-FSKALYENESANEAALSKIPMGRLGTSEEMAGVVSFLV 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3301NP_001287440.1 YdfG 1..250 CDD:226674 65/249 (26%)
NADB_Rossmann 1..245 CDD:304358 65/249 (26%)
CG10672NP_647946.1 NADB_Rossmann 67..317 CDD:304358 64/248 (26%)
fabG 67..316 CDD:235975 64/248 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435171
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.