DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3301 and dhs-6

DIOPT Version :9

Sequence 1:NP_001287440.1 Gene:CG3301 / 42528 FlyBaseID:FBgn0038878 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_001021972.1 Gene:dhs-6 / 3565470 WormBaseID:WBGene00000970 Length:418 Species:Caenorhabditis elegans


Alignment Length:281 Identity:64/281 - (22%)
Similarity:104/281 - (37%) Gaps:67/281 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 RWLNRVAVVTGASAGIGAACCRDLVAKGMVVVGLAR----REKVLQDIKSSLPADQAARFHTRPC 63
            :::.|..::||||.|||......|...|..:|..|:    ..|:...|.|:....:.|.....||
 Worm     6 KFVGRTVLITGASRGIGKEIALKLAKDGANIVVAAKTATAHPKLPGTIYSAAEEIEKAGGKALPC 70

  Fly    64 --DVSNEQQVIDTFAWIDRTLGGADVLVNNAGIIRQMNITDPENSADVRAIL--DVNVLGVTWCT 124
              ||.:|..|..:.....:..||.|:|:|||..|   ::||.||:...|..|  .:|..|....|
 Worm    71 IVDVRDEASVKASVEEAVKKFGGIDILINNASAI---SLTDTENTEMKRYDLMHSINTRGTFLMT 132

  Fly   125 R-------------------------QWFLSLQRRKVNDGHVVVINSVVGHSVPAV--------E 156
            :                         :||.:         ||....:..|.|:..:        .
 Worm   133 KTCLPYLKSGKNPHVLNISPPLLMETRWFAN---------HVAYTMAKYGMSMCVLGQHEEFRPH 188

  Fly   157 GFSLNMYAPSKHAITALTEILRQEFIKKGTQTKITSISPGVVATEIFEAGSWEQP--TG-----M 214
            |.::|...|.....||..|:|..:..:.|::      .|.::|...:...|....  ||     .
 Worm   189 GIAVNALWPLTAIWTAAMEMLSDKGGEAGSR------KPSIMADAAYAVLSKNSKDFTGNFCIDE 247

  Fly   215 PMLRSEDIADAVTY-CIQTPP 234
            .:|::|.:.|...| |:...|
 Worm   248 DILKAEGVTDFDRYACVPDAP 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3301NP_001287440.1 YdfG 1..250 CDD:226674 64/281 (23%)
NADB_Rossmann 1..245 CDD:304358 64/281 (23%)
dhs-6NP_001021972.1 PRK08278 9..275 CDD:181349 64/278 (23%)
SCP2 319..411 CDD:376720
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160156019
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.