DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3301 and ZK697.14

DIOPT Version :9

Sequence 1:NP_001287440.1 Gene:CG3301 / 42528 FlyBaseID:FBgn0038878 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_001024318.1 Gene:ZK697.14 / 3565013 WormBaseID:WBGene00022809 Length:249 Species:Caenorhabditis elegans


Alignment Length:220 Identity:47/220 - (21%)
Similarity:92/220 - (41%) Gaps:23/220 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 RVAVVTGASAGIGAACCRD-LVAKGM-VVVGLARREKVLQDIKSSLPADQAARFHTRPCDVSNEQ 69
            |..::|||:.|||....:. |..:|: :|:...|......::.|.  ||  :|....|.::..:.
 Worm     4 RSILITGANRGIGLGLVKQFLKNEGIQLVIATCRNPSKADELNSI--AD--SRLQIFPLEIDCDD 64

  Fly    70 QVIDTFAWIDRTLG--GADVLVNNAGIIRQMNITDPENSADVRAILDVNVLGVTWCTRQWFLSLQ 132
            .:...:..:|..:|  |..||:|||.|.....|....:...:|..::.|.:.....|:.:...|:
 Worm    65 SIKKLYENVDTLVGTDGLTVLINNAAICSVYEIEGQISRTYMRQQIETNSVSTAILTQNFIPLLK 129

  Fly   133 RRKVNDG-------HVVVIN-----SVVGHSVPAVEGFSLNMYAPSKHAITALTEILRQEFIKKG 185
            :....:|       ...::|     :.:|:......|..: .|..||.|:.:.::....|..|  
 Worm   130 KASAKNGGEEYSTDRAAIVNISSGAASIGYIDDKQPGIYI-AYRMSKSALNSFSKSCSVELAK-- 191

  Fly   186 TQTKITSISPGVVATEIFEAGSWEQ 210
            ....:|::.||.|.|::.....||:
 Worm   192 YHILVTAMCPGWVKTDMGGENGWEE 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3301NP_001287440.1 YdfG 1..250 CDD:226674 47/220 (21%)
NADB_Rossmann 1..245 CDD:304358 47/220 (21%)
ZK697.14NP_001024318.1 carb_red_sniffer_like_SDR_c 6..248 CDD:187586 46/218 (21%)
adh_short 6..211 CDD:278532 44/211 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160155972
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.