DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3301 and CG9150

DIOPT Version :9

Sequence 1:NP_001287440.1 Gene:CG3301 / 42528 FlyBaseID:FBgn0038878 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_608991.2 Gene:CG9150 / 33856 FlyBaseID:FBgn0031775 Length:251 Species:Drosophila melanogaster


Alignment Length:257 Identity:123/257 - (47%)
Similarity:164/257 - (63%) Gaps:13/257 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNRWLNRVAVVTGASAGIGAACCRDLVAKGMVVVGLARREKVLQDIKSSLPADQAARFHTRPCDV 65
            |.||.|::|||||||.||||||.|.::..|:.||||||||..|::::.|||.:..|.|..|.|||
  Fly     1 MERWQNKLAVVTGASGGIGAACARAMIGAGLRVVGLARREAKLKELRESLPRELQANFIPRRCDV 65

  Fly    66 SNEQQVIDTFAWIDRTLGGADVLVNNAGIIRQMNITDPENSADVRAILDVNVLGVTWCTRQWFLS 130
            |.|.||..:|.||:|.|.|||||:|||||.|:..:..|.|:..::.::|.||:||.||||:.|.:
  Fly    66 SKEDQVQSSFDWIERELEGADVLLNNAGITRETELVTPSNTQKLKEVIDTNVMGVIWCTREAFNN 130

  Fly   131 LQRRKVNDGHVVVINSVVGHSV-------PAVEGFSLNMYAPSKHAITALTEILRQEFIKKGTQT 188
            ::||. .:|||::|||:.||.|       |     |.|:|..:|.||||:||..||||.....:.
  Fly   131 MKRRG-GEGHVLIINSIAGHQVLNFIDVLP-----SFNIYPATKFAITAITETYRQEFQLHSNKI 189

  Fly   189 KITSISPGVVATEIFEAGSWEQPTGMPMLRSEDIADAVTYCIQTPPTVQIKELIIKPVGEGF 250
            ::|.|.||.|.|.||..........|..|...:|||||.|.::|||.||:.|:.|||:||.|
  Fly   190 RVTGICPGAVNTNIFPEEIHFYVKDMARLEPANIADAVMYALRTPPHVQVHEITIKPMGEMF 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3301NP_001287440.1 YdfG 1..250 CDD:226674 122/255 (48%)
NADB_Rossmann 1..245 CDD:304358 118/250 (47%)
CG9150NP_608991.2 YdfG 1..251 CDD:226674 122/255 (48%)
NADB_Rossmann 1..247 CDD:304358 119/251 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442650
Domainoid 1 1.000 86 1.000 Domainoid score I2775
eggNOG 1 0.900 - - E2759_KOG1205
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 87 1.000 Inparanoid score I2312
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG45743
OrthoDB 1 1.010 - - D101130at6960
OrthoFinder 1 1.000 - - FOG0000588
OrthoInspector 1 1.000 - - mtm6354
orthoMCL 1 0.900 - - OOG6_100320
Panther 1 1.100 - - P PTHR43115
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X367
1110.900

Return to query results.
Submit another query.