DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3301 and CG31937

DIOPT Version :9

Sequence 1:NP_001287440.1 Gene:CG3301 / 42528 FlyBaseID:FBgn0038878 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_608616.2 Gene:CG31937 / 326177 FlyBaseID:FBgn0031360 Length:321 Species:Drosophila melanogaster


Alignment Length:292 Identity:73/292 - (25%)
Similarity:116/292 - (39%) Gaps:68/292 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 RVAVVTGASAGIGAACCRDLVAKGMVVVGLARREKVLQDIKSSLPADQAARFHTRPCDV------ 65
            :|..:||||:|||.|....|...|:.:|..|||.:.|:.::....|  |||......||      
  Fly    47 QVVWITGASSGIGRALALSLARHGVKLVLSARRLEQLEQVQEECLA--AARGLLATKDVLVIQMD 109

  Fly    66 --------SNEQQVIDTFAWIDRTLGGADVLVNNAGIIRQMNITDPENSADVRAILDVNVLGVTW 122
                    ::...|::.|..:       ||||||||..::.:.|:.|...| |.:.:::|..|..
  Fly   110 MLDLDEHKTHLNTVLNHFHRL-------DVLVNNAGRSQRASWTEVEIEVD-RELFELDVFAVVH 166

  Fly   123 CTRQWFLSLQRRKVNDGHVVVINSVVGHS-VPAVEGFSLNMYAPSKHAITALTEILRQEFIKKGT 186
            .:|........:....||:...:|:.|.| ||    || ..|..:|||:.|....|:.|..|   
  Fly   167 LSRLVVRYFVEQNGGRGHIAATSSIAGFSPVP----FS-PTYCAAKHALNAYLLSLKVEMRK--- 223

  Fly   187 QTKITSISPGVVATEIFE---AGSWEQPTG--------MPMLRSEDI------------------ 222
             ..::..:||.:||:..:   .||.....|        |...|..|:                  
  Fly   224 -LDVSLFAPGPIATDFLQEAFTGSQGGKVGLSTANQKRMTAQRCGDLFAVALANKMDLTWCGLFP 287

  Fly   223 ADAVTYCIQTPPTVQI-----KELIIKPVGEG 249
            .:.:.||.:.|...:|     .|..:..:.||
  Fly   288 VNLLAYCARNPTLSKILAQLMTEKTLNKIREG 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3301NP_001287440.1 YdfG 1..250 CDD:226674 73/292 (25%)
NADB_Rossmann 1..245 CDD:304358 71/286 (25%)
CG31937NP_608616.2 NADB_Rossmann 44..293 CDD:304358 66/264 (25%)
adh_short 47..245 CDD:278532 60/216 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435066
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1205
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.