DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3301 and CG31548

DIOPT Version :9

Sequence 1:NP_001287440.1 Gene:CG3301 / 42528 FlyBaseID:FBgn0038878 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_730974.1 Gene:CG31548 / 318794 FlyBaseID:FBgn0051548 Length:256 Species:Drosophila melanogaster


Alignment Length:248 Identity:70/248 - (28%)
Similarity:99/248 - (39%) Gaps:66/248 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNRWLNRVAVVTGASAGIGAA---------CCRDLVAKGMVVVGLARREKVLQDIKSSLPADQAA 56
            || :..:|.::||||:|||||         .|  |...|..|..|.:.......:..|.||....
  Fly     1 MN-FAGKVVLITGASSGIGAATAIKFAKYGAC--LALNGRNVENLKKVAAECSKVSQSQPALVVG 62

  Fly    57 RFHTRPCDVSNEQQVIDTFAWIDRTL---GGADVLVNNAGIIRQMNIT-------DPENSADVRA 111
                   |::.|   .||......||   |..||||||||||....|.       |...:.::||
  Fly    63 -------DIAKE---ADTQRIWSETLQQYGKLDVLVNNAGIIETGTIETTSLEQYDRVMNTNLRA 117

  Fly   112 ILDVNVLGVTWCTRQWFLSLQRRKVNDGHVVVINSVVG-HSVPAVEGFSLNMYAPSKHAITALTE 175
            |..:.:|...        .|.:.|   |::|.::||.| .|.|.|..:::     ||..:...|.
  Fly   118 IYHLTMLATP--------ELVKTK---GNIVNVSSVNGIRSFPGVLAYNI-----SKMGVDQFTR 166

  Fly   176 ILRQEFIKKGTQTKITSISPGVVATEIFEAGSWEQPTGMPMLRSEDIADAVTY 228
            .:..|...||  .::..::|||..|.:...|      ||         ||.||
  Fly   167 CVALELAAKG--VRVNCVNPGVTVTNLHARG------GM---------DAETY 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3301NP_001287440.1 YdfG 1..250 CDD:226674 70/248 (28%)
NADB_Rossmann 1..245 CDD:304358 70/248 (28%)
CG31548NP_730974.1 fabG 1..250 CDD:235975 70/248 (28%)
NADB_Rossmann 3..253 CDD:304358 68/245 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435144
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.