DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3301 and rdh8a

DIOPT Version :9

Sequence 1:NP_001287440.1 Gene:CG3301 / 42528 FlyBaseID:FBgn0038878 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_957001.1 Gene:rdh8a / 280648 ZFINID:ZDB-GENE-021115-3 Length:318 Species:Danio rerio


Alignment Length:254 Identity:64/254 - (25%)
Similarity:114/254 - (44%) Gaps:49/254 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 RVAVVTGASAGIGAACCRDLVAKGMVVVGLARREK-------VLQDIKSSLPADQAA------RF 58
            :|.::||.|:|||.          .:.|.|||.|:       .::|:|......:||      ..
Zfish     8 KVVLITGCSSGIGL----------RIAVLLARDEQKRYHVIATMRDLKKKDRLVEAAGEVYGQTL 62

  Fly    59 HTRPCDVSNEQQVIDTFAWI-DRTLGGADVLVNNAGIIRQMNITDPENSA---DVRAILDVNVLG 119
            ...|.|:.:::.|......: ||.:   |||:||||:    .:..|..|.   :::.:.:.|..|
Zfish    63 TLLPLDICSDESVRQCVNSVKDRHI---DVLINNAGV----GLLGPVESISMDEMKRVFETNFFG 120

  Fly   120 VTWCTRQWFLSLQRRKVNDGHVVVINSVVGHSVPAVEGFSLN-MYAPSKHAITALTEILRQEFIK 183
            .....::....:::|:.  ||:::::||:|     ::|...| :|..||.||....|.:..:.:|
Zfish   121 TVRMIKEVMPDMKKRQA--GHIIIMSSVMG-----LQGVVFNDVYTASKFAIEGFCESMAVQLLK 178

  Fly   184 KGTQTKITSISPGVVATEIFEAGSWEQPTGMPMLRSEDIADAVTYC--IQTPPTVQIKE 240
              ...|::.|.||.|.|| ||....|:...|....::  .|.|.|.  :..|.::.|.|
Zfish   179 --FNVKLSLIEPGPVHTE-FETKMMEEVAKMEYPGAD--PDTVRYFKDVYVPSSIDIFE 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3301NP_001287440.1 YdfG 1..250 CDD:226674 64/254 (25%)
NADB_Rossmann 1..245 CDD:304358 64/254 (25%)
rdh8aNP_957001.1 type1_17beta-HSD-like_SDR_c 8..265 CDD:187666 64/254 (25%)
adh_short 8..207 CDD:278532 57/225 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1205
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.