DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3301 and SPCC162.03

DIOPT Version :9

Sequence 1:NP_001287440.1 Gene:CG3301 / 42528 FlyBaseID:FBgn0038878 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_588241.1 Gene:SPCC162.03 / 2539382 PomBaseID:SPCC162.03 Length:292 Species:Schizosaccharomyces pombe


Alignment Length:209 Identity:58/209 - (27%)
Similarity:100/209 - (47%) Gaps:28/209 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 VVTGASAGIGAACCRDLVAKGMVVVGLARREKVLQDIKSSLPADQAARFHTR----PCDVSNEQQ 70
            ::||:|.|:|.|         :|.||||:...|   |..|...|.....|::    ..||::.:.
pombe     9 LITGSSKGLGYA---------LVKVGLAQGYNV---IACSRAPDTITIEHSKLLKLKLDVTDVKS 61

  Fly    71 VIDTFAWIDRTLGGADVLVNNA--GIIRQMNITDPENSADVRAILDVNVLGVTWCTRQWFLSLQR 133
            |...|....|..|..|:::|||  |::.:.   :..|..::...::||..||.:.|:: .|:|.|
pombe    62 VETAFKDAKRRFGNVDIVINNAGYGLVGEF---ESYNIEEMHRQMNVNFWGVAYITKE-ALNLMR 122

  Fly   134 RKVNDGHVVVINSVVGHSVPAVEGFSLNMYAPSKHAITALTEILRQEFIKKGTQTKITSISPGVV 198
            .....|.::.|:||.|: .|:.   .|:||..||.|:..|::.:.:| :.......||.:.||.:
pombe   123 ESGKGGRILQISSVAGY-YPSP---CLSMYNASKFAVEGLSQTIMRE-LDPNWNIAITIVQPGGM 182

  Fly   199 ATEIFEAG-SWEQP 211
            .||...:. .|.:|
pombe   183 QTEWASSNMQWAKP 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3301NP_001287440.1 YdfG 1..250 CDD:226674 58/209 (28%)
NADB_Rossmann 1..245 CDD:304358 58/209 (28%)
SPCC162.03NP_588241.1 17beta-HSD-like_SDR_c 7..248 CDD:187632 58/209 (28%)
PRK08263 9..257 CDD:181334 58/209 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 97 1.000 Domainoid score I1885
eggNOG 1 0.900 - - E2759_KOG1205
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000588
OrthoInspector 1 1.000 - - otm47108
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.900

Return to query results.
Submit another query.