DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3301 and Hsd17b1

DIOPT Version :9

Sequence 1:NP_001287440.1 Gene:CG3301 / 42528 FlyBaseID:FBgn0038878 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_036983.1 Gene:Hsd17b1 / 25322 RGDID:2836 Length:344 Species:Rattus norvegicus


Alignment Length:189 Identity:59/189 - (31%)
Similarity:82/189 - (43%) Gaps:42/189 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VAVVTGASAGIGAACCRDLVAKGMVVVGLARREK-------VLQDIKSSLPADQAARFHTRP--- 62
            |.::||.|:|||.          .:.|.||....       .|:|:||..|..:|||....|   
  Rat     5 VVLITGCSSGIGL----------HLAVRLASDRSQSFKVYATLRDLKSQGPLLEAARAQGCPPGS 59

  Fly    63 -----CDVSNEQQVIDTFAWIDRTLGGADVLVNNAGIIRQMNITDPENSAD---VRAILDVNVLG 119
                 .||.:.:.|....|.:  |.|..||||.|||    ..:..|..:.:   |.|:|||||||
  Rat    60 LEILELDVRDSESVAAARACV--TEGRVDVLVCNAG----RGLFGPLEAHELNAVGAVLDVNVLG 118

  Fly   120 VTWCTRQWFLSLQRRKVNDGHVVVINSVVG-HSVPAVEGFSLNMYAPSKHAITALTEIL 177
            .....:.:...::||  :.|.|:|..||.| ..:|..|     :|..||.|:..|.|.|
  Rat   119 TIRMLQAFLPDMKRR--HSGRVLVTASVGGLMGLPFHE-----VYCASKFALEGLCESL 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3301NP_001287440.1 YdfG 1..250 CDD:226674 59/189 (31%)
NADB_Rossmann 1..245 CDD:304358 59/189 (31%)
Hsd17b1NP_036983.1 NADB_Rossmann 4..260 CDD:419666 59/189 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1205
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.