DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3301 and Rdh8

DIOPT Version :9

Sequence 1:NP_001287440.1 Gene:CG3301 / 42528 FlyBaseID:FBgn0038878 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_001025461.1 Gene:Rdh8 / 235033 MGIID:2685028 Length:317 Species:Mus musculus


Alignment Length:271 Identity:67/271 - (24%)
Similarity:107/271 - (39%) Gaps:66/271 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 RVAVVTGASAGIGAACCRDLV----AKGMVVVGLARREKVLQDIKSSLPADQAA------RFHTR 61
            |..:::|.|:|||......|.    .:..||.       .::|:....|.:.||      .....
Mouse     6 RTVLISGCSSGIGLELALQLAHDPRQRYQVVA-------TMRDLGKKEPLEAAAGEALGKTLSVV 63

  Fly    62 PCDVSNEQQVIDTFAWIDRTLGGADVLVNNAGIIRQMNITDPENS---ADVRAILDVNVLGVTWC 123
            ..||.|::.|.|..:.|:.  |..||||||||:    .:..|...   |.::::.:.|..|....
Mouse    64 QLDVCNDESVTDCLSHIEG--GQVDVLVNNAGV----GLVGPLEGLSLATMQSVFNTNFFGAVRL 122

  Fly   124 TRQWFLSLQRRKVNDGHVVVINSVVGHSVPAVEGFSLN-MYAPSKHAITALTEILRQEFIKKGTQ 187
            .:.....::||:  .||:||::||:|     ::|...| :||.||.|:....|.|..:.  :...
Mouse   123 VKAVLPGMKRRR--QGHIVVVSSVMG-----LQGVMFNDVYAASKFALEGFFESLAIQL--RQFN 178

  Fly   188 TKITSISPGVVATEIFEAGSWEQ----------------------PTGMPMLRS-----EDIADA 225
            ..|:.:.||.|.|: ||.....|                      |....:.||     .|:|..
Mouse   179 IFISMVEPGPVTTD-FEGKLLAQVSKAEFPDTDPDTLGYFRDLYLPASRELFRSVGQSPRDVAQV 242

  Fly   226 VTYCIQT--PP 234
            :...|.|  ||
Mouse   243 IAKVIGTTRPP 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3301NP_001287440.1 YdfG 1..250 CDD:226674 67/271 (25%)
NADB_Rossmann 1..245 CDD:304358 67/271 (25%)
Rdh8NP_001025461.1 NADB_Rossmann 6..263 CDD:304358 67/271 (25%)
adh_short 6..201 CDD:278532 57/217 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1205
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.